close all open/close all

CDS information : Meili_00700


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction140,258 / 141,583 / + [in whole cluster]
140,258 / 141,583 / + [in contig]
Location140258..141583 [in whole cluster]
140258..141583 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf61

close this sectionSequence

selected fasta
>[hypothetical protein]
MRRICLTLPTNRACPAMVTAIGEEAAYAAAHFDVEVHLLVLDSSDAFAEHARALRSAHGL
PRVVVHHLDEAEQRDFLRRVIHRTEHTKHELLLDLMLPAGLSYGACTNRAFLIAVALGCE
SVHRRDSDSRYQVLRGETVFPVHQELLSLGKRAADAAHGVGETVLAPENTHKRVAMVAGS
FLGELSVDIDEIRRLDPDVYYDVVGLWAPGHWSDEQKRELVEESFQGPRTGPFTGDRTTL
TVVDPMHVDMCNISFHQVHERVPLPPATDTIGSDYFLIHLVHAAALPGVLHNRHIVNFYT
GERRTDPGFMAYQLRFAKFFLSMLYFNFLYDEMAEAGASLLDGRGQVRASAIAELARKST
QLDRAENVQRLDTIEAAYRKLGGRYATFAAFLASRRERLLDEAQSDIADFALLIETWEAL
IRAARDTALVQAPEHPGRRSR
selected fasta
>[hypothetical protein]
GTGCGACGCATCTGCCTGACACTCCCCACCAACCGGGCCTGCCCCGCGATGGTCACCGCC
ATCGGTGAGGAAGCCGCCTACGCGGCCGCGCACTTCGACGTCGAAGTGCATCTGCTCGTC
CTCGACTCCTCCGACGCGTTTGCGGAACACGCACGGGCCCTGCGCTCCGCGCACGGGCTG
CCGCGCGTCGTCGTCCACCACCTCGACGAGGCGGAGCAGCGCGACTTTCTGCGCCGGGTG
ATCCACCGGACCGAGCACACCAAGCATGAGCTGCTGCTCGACCTCATGCTTCCGGCCGGG
CTCTCCTACGGCGCCTGCACCAACCGCGCGTTCCTGATCGCCGTGGCCCTCGGATGCGAA
TCCGTCCACCGCAGGGACTCCGACAGCCGCTACCAGGTGCTGCGCGGCGAGACCGTGTTC
CCCGTCCACCAGGAGCTTCTGTCGCTCGGCAAGCGCGCTGCCGACGCGGCGCACGGTGTC
GGTGAGACGGTGCTCGCTCCCGAGAACACCCACAAGCGGGTGGCGATGGTGGCCGGCTCC
TTCCTGGGTGAGCTGTCCGTGGACATCGACGAGATCCGCCGGCTCGACCCGGACGTCTAC
TACGACGTGGTCGGCCTGTGGGCGCCCGGCCACTGGTCGGACGAGCAGAAGCGGGAACTC
GTCGAGGAGTCCTTCCAAGGGCCCAGGACCGGCCCGTTCACCGGTGACCGGACGACCTTG
ACCGTCGTCGACCCCATGCACGTGGACATGTGCAACATCAGCTTCCACCAGGTGCATGAA
CGAGTGCCGCTGCCGCCCGCGACCGACACCATCGGCAGCGACTACTTCCTCATCCACCTG
GTCCACGCCGCCGCGCTGCCCGGCGTACTGCACAACCGCCACATCGTGAACTTCTACACA
GGGGAACGCCGCACCGACCCGGGGTTCATGGCCTACCAGCTGCGGTTCGCCAAGTTCTTC
CTGTCGATGCTCTACTTCAACTTCCTCTACGACGAGATGGCCGAGGCCGGCGCATCGCTC
CTCGACGGTCGAGGTCAGGTGCGGGCGTCCGCCATCGCCGAGCTGGCCAGGAAGAGCACC
CAGCTCGACCGGGCGGAGAACGTCCAGCGCCTCGACACCATCGAGGCCGCGTACCGGAAG
CTCGGCGGCAGATACGCCACCTTCGCCGCCTTCCTGGCGTCGCGCCGCGAGCGTCTGCTC
GACGAGGCGCAGAGCGACATCGCCGACTTCGCCCTGCTGATCGAGACGTGGGAGGCGCTG
ATACGGGCGGCCCGCGACACCGCCCTCGTCCAGGCTCCGGAACATCCGGGTCGAAGGTCA
CGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  0.84 Signal
Bacteria, Gram-positive   
TMHMM No significant hit