close all open/close all

CDS information : Meili_00710


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction141,628 / 142,818 / + [in whole cluster]
141,628 / 142,818 / + [in contig]
Location141628..142818 [in whole cluster]
141628..142818 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)lysine/ornithine decarboxylase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf62

close this sectionSequence

selected fasta
>[lysine/ornithine decarboxylase]
MSAALAATADDRIVFDLTGIEERYESLLRELPGVAVRFAMKACPVDEVLARLAGAGAGVD
AASVPEMEQALRAGVPIGRVHYGNTVKSDRNIADAHRLGIRDFATDSLEDVAAIAEHAPG
ARVFCRLTTDTRGALWELSGKYGCSTADAVTILETARKLGLVPSGLSVHVGSQQMAPEAW
RDAFERLADVLAALDHHGIALDHINLGGGLPVPGYLDKHGRPLDPPIDKLFAVIREGMAH
LRTIGGHHLAFVVEPGRYLVAGQGAIRAHVSRLSARRGPDGRRQYWLYLSCGKFNGLYEM
DELQYPLVFPTHGGPGTRHVPAVVAGPTCDSDDAYSHQDGLVQVPEALASGDPVWVLSCG
AYAISYTTQGFNGFGPLPYTCIDGGATGGSAKAGGG
selected fasta
>[lysine/ornithine decarboxylase]
TTGTCCGCCGCGCTCGCGGCCACCGCCGACGACCGGATCGTCTTCGACCTCACCGGAATC
GAGGAGCGCTACGAGTCCCTGCTCCGGGAGTTGCCCGGGGTCGCCGTCCGCTTCGCCATG
AAGGCCTGCCCTGTCGACGAGGTGCTGGCCCGGCTGGCCGGGGCGGGCGCCGGGGTCGAC
GCGGCAAGCGTCCCGGAGATGGAACAGGCGCTGCGGGCGGGTGTGCCGATCGGCAGAGTG
CACTACGGCAACACTGTGAAGTCCGACCGGAACATCGCCGACGCCCATCGGCTCGGGATC
AGGGACTTCGCGACCGACAGCCTGGAGGACGTGGCGGCCATCGCCGAACACGCCCCCGGC
GCCCGGGTGTTCTGCAGGCTCACCACCGACACCCGGGGAGCGCTCTGGGAGCTGAGCGGC
AAGTACGGATGCTCGACCGCCGACGCGGTGACCATCCTGGAGACGGCCCGCAAGCTGGGG
CTGGTGCCCTCCGGCCTCTCCGTCCACGTCGGCTCGCAGCAGATGGCGCCCGAGGCCTGG
CGCGACGCCTTCGAACGCCTCGCGGACGTCCTGGCCGCCCTGGACCACCACGGGATCGCC
CTGGACCACATCAACCTCGGCGGCGGCCTCCCCGTCCCGGGGTATCTCGACAAACACGGC
AGACCGCTCGATCCCCCGATCGACAAGTTGTTCGCCGTCATCCGGGAGGGAATGGCCCAC
CTGCGCACCATCGGCGGACATCACCTCGCCTTCGTCGTGGAGCCGGGCCGCTATCTCGTC
GCCGGACAAGGGGCCATCCGGGCCCATGTGTCCCGGCTGTCCGCGCGACGGGGACCCGAC
GGGCGGCGCCAGTACTGGCTGTATCTGAGCTGCGGAAAGTTCAACGGCCTGTACGAGATG
GACGAGTTGCAGTACCCGCTCGTCTTCCCCACCCACGGCGGCCCCGGCACCCGCCATGTG
CCCGCCGTCGTGGCCGGACCCACCTGCGACAGCGACGACGCCTACTCCCACCAGGACGGC
CTGGTCCAGGTGCCCGAGGCGCTGGCGTCCGGCGACCCGGTCTGGGTGCTGTCCTGCGGG
GCGTACGCGATCAGCTATACGACCCAGGGCTTCAACGGCTTCGGCCCGCTCCCCTACACC
TGCATAGACGGCGGCGCCACGGGCGGGTCCGCGAAGGCGGGTGGCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000183 Ornithine/DAP/Arg decarboxylase (Family)
 [38-56]  7.09999884211141e-11 PR01179 [58-70]  7.09999884211141e-11 PR01179 [160-173]  7.09999884211141e-11 PR01179 [251-270]  7.09999884211141e-11 PR01179
PR01179   ODADCRBXLASE
IPR002433 Ornithine decarboxylase (Family)
 [10-34]  2.89999717862184e-10 PR01182 [36-63]  2.89999717862184e-10 PR01182 [80-104]  2.89999717862184e-10 PR01182 [110-132]  2.89999717862184e-10 PR01182 [323-333]  2.89999717862184e-10 PR01182
PR01182   ORNDCRBXLASE
IPR009006 Alanine racemase/group IV decarboxylase, C-terminal (Domain)
 [233-387]  2.19999900980708e-20 SSF50621
SSF50621   Racem_decarbox_C
 [246-385]  3.3e-17 G3DSA:2.40.37.10
G3DSA:2.40.37.10   Ala_racemase/Decarboxylase_C
IPR022643 Orn/DAP/Arg decarboxylase 2, C-terminal (Domain)
 [281-377]  3.7e-13 PF00278
PF00278   Orn_DAP_Arg_deC
IPR022644 Orn/DAP/Arg decarboxylase 2, N-terminal (Domain)
 [30-261]  2.19999999999997e-39 PF02784
PF02784   Orn_Arg_deC_N
IPR022653 Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site (Binding_site)
 [38-56]  PS00878
PS00878   ODR_DC_2_1
IPR022657 Orn/DAP/Arg decarboxylase 2, conserved site (Conserved_site)
 [198-211]  PS00879
PS00879   ODR_DC_2_2
SignalP No significant hit
TMHMM No significant hit