close all open/close all

CDS information : Meili_00720


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction142,827 / 143,357 / + [in whole cluster]
142,827 / 143,357 / + [in contig]
Location142827..143357 [in whole cluster]
142827..143357 [in contig]
TypeCDS
Length531 bp (176 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf63

close this sectionSequence

selected fasta
>[hypothetical protein]
MRIRHISEDDWDGIAALESHTYTGLGLSEGRVALESRARVSPATCRALEVGPRLVGYALA
LPYPMYRYPDLERPEETAYPSTNLHLHDLVIAENFRRQGLGRRLLRHLTASAGAHGYEQI
SLVAVGGSATYWSARGFTAHQEVVPPDGYGPDVIYMSRAVPSGVSAHGASSQEEQA
selected fasta
>[hypothetical protein]
GTGCGCATCCGCCACATCTCAGAGGACGACTGGGACGGCATCGCGGCGCTGGAGTCCCAC
ACCTACACCGGCCTCGGCCTGTCCGAGGGACGGGTGGCGCTCGAATCCCGCGCACGGGTG
TCGCCGGCCACCTGCCGCGCGCTGGAGGTGGGCCCCCGGCTCGTGGGCTATGCGCTGGCG
CTGCCCTATCCGATGTACCGGTACCCGGACCTGGAACGGCCCGAGGAGACCGCGTACCCG
TCCACCAATCTGCATCTGCACGACCTGGTCATCGCGGAGAACTTCCGGCGCCAAGGGCTG
GGACGGCGCCTGCTGCGCCACCTCACCGCATCGGCCGGGGCGCATGGGTACGAGCAGATC
TCGCTGGTGGCCGTCGGGGGCAGCGCGACGTACTGGTCGGCGCGTGGCTTCACCGCCCAC
CAGGAGGTCGTCCCCCCGGACGGCTACGGCCCGGACGTCATCTACATGTCGAGGGCGGTG
CCGTCCGGCGTGTCCGCTCATGGCGCGTCATCGCAGGAGGAGCAGGCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [49-137]  5.59999999999999e-11 PF00583
PF00583   Acetyltransf_1
 [1-161]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [1-158]  3.2e-22 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [1-158]  2.30000440726534e-23 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit