close all open/close all

CDS information : Meili_00730


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction143,354 / 144,553 / + [in whole cluster]
143,354 / 144,553 / + [in contig]
Location143354..144553 [in whole cluster]
143354..144553 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transmembrane transport protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf64

close this sectionSequence

selected fasta
>[transmembrane transport protein]
MIHIPRVRDPFYRSQLAIAALFCSLGFQYATWASRIPALKADLGLTAAEVGFLLMAAGVG
ASVSFPLVSVLMRRLGSQRLALLSALGLTLVLIALAMAPNYPVALAVVCCDGVLVGCLNV
AMNAQGAALEVRHKRNAMAKLHATFSGGSLLAALLASGVNAVTSTVAVHFGMAAVVLLLL
FAYARTGLLAEDEAAEEKRDETKSRTGWSLPTRMTLWMCCAMVFGTVTEGAINDWSALYM
TDVVKASAQLAPLGIAVVSGMMVLARLFADGWRERWGDGRVVVLGSALAGTGLALALLSG
GVVPALIGFSCVGLGIAAVTPCVYVAAAKQGPDALALVAAMGTTGLLAGPPVIGFVANSS
SLVWGLGVVAASAAVVSLCGTRVQWTPPANALGTEVPGR
selected fasta
>[transmembrane transport protein]
TTGATCCATATACCGCGGGTCCGAGATCCCTTCTACCGGAGCCAACTGGCGATCGCCGCG
CTGTTCTGCTCCCTCGGTTTCCAGTACGCCACCTGGGCCTCGCGCATCCCCGCCCTCAAG
GCCGATCTCGGCCTGACGGCCGCGGAGGTGGGCTTCCTCCTGATGGCCGCGGGGGTCGGC
GCGAGTGTGTCATTCCCCCTTGTGTCGGTGCTGATGAGGCGGCTGGGCTCACAGCGCCTC
GCACTCCTGTCGGCCCTGGGCCTGACGCTGGTACTCATCGCCCTGGCCATGGCGCCGAAC
TACCCCGTCGCCTTGGCCGTCGTGTGCTGCGACGGAGTGCTCGTGGGCTGTCTGAACGTC
GCCATGAACGCACAGGGCGCCGCGCTCGAAGTCCGGCACAAGCGCAACGCCATGGCCAAA
CTGCACGCGACGTTCAGCGGCGGCTCGCTGCTCGCCGCCCTCCTGGCCTCCGGCGTCAAC
GCGGTGACCTCGACGGTCGCCGTGCACTTCGGCATGGCCGCCGTCGTCCTGCTGCTCCTG
TTCGCCTACGCCCGCACCGGGCTGCTGGCGGAGGACGAGGCCGCCGAGGAGAAGCGGGAC
GAGACGAAGAGCCGCACCGGATGGTCCCTGCCGACCCGTATGACGCTGTGGATGTGCTGC
GCCATGGTCTTCGGCACCGTCACCGAGGGCGCCATCAACGACTGGTCGGCCCTCTATATG
ACGGATGTCGTCAAGGCGTCGGCACAGCTGGCGCCCCTGGGCATCGCCGTCGTCTCGGGC
ATGATGGTGCTGGCCCGGCTGTTCGCCGACGGCTGGCGAGAGCGCTGGGGCGACGGGCGG
GTCGTCGTCCTCGGCAGCGCCCTGGCCGGGACGGGGCTGGCCCTCGCCCTGCTGAGTGGC
GGTGTGGTTCCGGCCCTGATCGGCTTCTCCTGCGTCGGCCTCGGCATCGCGGCCGTGACC
CCTTGCGTCTATGTCGCGGCGGCCAAGCAGGGCCCGGACGCTCTGGCCCTGGTCGCCGCC
ATGGGCACGACAGGCCTGCTGGCCGGTCCCCCGGTCATCGGCTTCGTGGCGAACTCCAGC
AGTCTGGTGTGGGGTCTGGGTGTCGTGGCCGCTTCGGCGGCCGTGGTGTCCCTGTGCGGT
ACGCGCGTCCAGTGGACGCCACCCGCTAACGCCTTGGGAACGGAAGTTCCTGGCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [20-330]  4.29999999999999e-22 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-383]  4.19999771339582e-38 SSF103473
SSF103473   MFS_gen_substrate_transporter
SignalP
 [1-30]  0.535 Signal
Bacteria, Gram-negative   
 [1-33]  0.8 Signal
Eukaryota   
 [1-30]  0.339 Signal
Bacteria, Gram-positive   
TMHMM
 [12-34]  Transmembrane (i-o) [49-71]  Transmembrane (o-i) [80-97]  Transmembrane (i-o) [101-120]  Transmembrane (o-i) [141-163]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [210-232]  Transmembrane (i-o) [247-269]  Transmembrane (o-i) [281-300]  Transmembrane (i-o) [305-327]  Transmembrane (o-i) [334-356]  Transmembrane (i-o) [361-380]  Transmembrane (o-i)
Transmembrane 12