close all open/close all

CDS information : Meili_00740


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction145,820 / 144,519 / - [in whole cluster]
145,820 / 144,519 / - [in contig]
Locationcomplement(144519..145820) [in whole cluster]
complement(144519..145820) [in contig]
TypeCDS
Length1,302 bp (433 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glycoside hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf65

close this sectionSequence

selected fasta
>[glycoside hydrolase]
MPKILARIRPPAFPRRTFTITHYGAVGDGQKMNTEAFRAAIAACHRAGGGHVLVPEGRFL
TGAIHLRSGVDLHVTEGATIAFSPDPRDFLPVVFTRWEGTECYNYSPFIYAYGERNVAVT
GPGTLDGQARLGPWESWYRSSGPQGPDQSLLRRMGSAGVPVAERVFGDGHYLRPKMVQFY
RCRNVLVSGLTIVDPPMWTVHPVLSTNVTVRDITVDSTLYNTDGCDPECCSDVLITGCRF
NTNDDCVAVKSGRDEDGHRVGVPSRNIVVRDCWFSGRWGGMTVGSEMSGGVRDVFAENCE
INSPDFPGRYPVKHALYVKASKKRGGYIDGVHIRNFTGQSVERDAVFVNMNYNGGEGGTL
PVSVRNIHMDRMEIDGARAVLQLVGLETDHLRGVSLSRSTFTGILSPDSIAYTDELTFRR
VYVNGQELPFPRR
selected fasta
>[glycoside hydrolase]
GTGCCGAAGATCCTGGCCCGGATCAGGCCGCCCGCCTTCCCCCGCCGGACCTTCACCATC
ACCCACTACGGCGCGGTCGGTGACGGGCAGAAGATGAACACCGAGGCGTTCCGGGCCGCC
ATCGCCGCGTGCCACCGCGCCGGCGGCGGCCACGTACTCGTCCCCGAGGGGCGTTTCCTC
ACCGGCGCGATCCATCTGCGCAGCGGCGTGGACCTGCACGTCACCGAGGGCGCCACCATC
GCCTTCAGCCCCGATCCGCGCGACTTCCTGCCGGTGGTGTTCACCCGCTGGGAGGGCACC
GAATGCTACAACTACTCGCCCTTCATCTACGCCTACGGTGAGCGCAACGTCGCGGTCACC
GGTCCCGGCACCCTCGACGGGCAGGCGCGGCTCGGGCCGTGGGAGAGCTGGTACCGCTCC
AGCGGACCGCAGGGTCCCGACCAGAGCCTGCTGCGCCGAATGGGTTCCGCGGGCGTGCCG
GTGGCCGAACGTGTCTTCGGCGACGGCCACTATCTGCGGCCGAAGATGGTGCAGTTCTAC
CGCTGCCGCAATGTCCTGGTCAGCGGCCTGACCATCGTCGACCCGCCGATGTGGACCGTG
CACCCCGTGCTGTCGACCAACGTCACCGTGCGCGACATCACGGTGGACAGCACGCTCTAC
AACACCGACGGATGCGACCCGGAGTGCTGCTCCGACGTGCTCATCACCGGCTGTCGCTTC
AACACCAACGACGACTGCGTCGCCGTCAAGTCCGGCCGCGACGAGGACGGCCACCGCGTC
GGCGTGCCGAGCCGGAACATCGTCGTACGCGACTGCTGGTTCTCCGGCCGCTGGGGCGGG
ATGACGGTCGGCAGCGAGATGTCCGGCGGGGTGCGCGATGTCTTCGCCGAGAACTGCGAG
ATCAACTCACCGGACTTTCCCGGCCGTTACCCCGTCAAGCACGCCCTGTACGTCAAGGCC
AGCAAGAAGCGCGGTGGCTATATCGACGGTGTGCACATCCGGAACTTCACCGGGCAGAGC
GTCGAGCGCGACGCGGTGTTCGTGAACATGAACTACAACGGTGGCGAGGGCGGGACGCTG
CCGGTGTCCGTACGGAACATCCACATGGACCGGATGGAGATCGACGGCGCCCGCGCCGTA
CTGCAACTGGTCGGCCTGGAGACCGACCATCTGCGGGGCGTCAGCCTCTCCCGTTCCACA
TTCACGGGCATCCTCAGCCCCGACAGCATCGCCTACACCGACGAACTGACCTTCCGGCGG
GTCTACGTCAACGGCCAGGAACTTCCGTTCCCAAGGCGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000743 Glycoside hydrolase, family 28 (Family)
 [174-370]  8.1e-20 PF00295
PF00295   Glyco_hydro_28
IPR006626 Parallel beta-helix repeat (Repeat)
 [205-229]  8.69999947780182 SM00710 [230-251]  0.0160000021104191 SM00710 [264-285]  1.20000000113801 SM00710 [291-320]  26.0000018086268 SM00710 [323-350]  16.0000021104191 SM00710
SM00710   PbH1
IPR011050 Pectin lyase fold/virulence factor (Domain)
 [10-402]  8.50003024809048e-89 SSF51126
SSF51126   Pectin_lyas_like
IPR012334 Pectin lyase fold (Domain)
 [4-428]  5.09999999999993e-110 G3DSA:2.160.20.10
G3DSA:2.160.20.10   Pectin_lyas_fold
SignalP
 [1-24]  0.495 Signal
Bacteria, Gram-positive   
TMHMM No significant hit