close all open/close all

CDS information : Meili_00750


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction148,932 / 145,963 / - [in whole cluster]
148,932 / 145,963 / - [in contig]
Locationcomplement(145963..148932) [in whole cluster]
complement(145963..148932) [in contig]
TypeCDS
Length2,970 bp (989 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf66

close this sectionSequence

selected fasta
>[hypothetical protein]
MPTLRIPLRPLRIRAARAARAARTWWRTLCAALVLALAVGLLTAPAADAEVQHPRQEWLR
ASTAGLFLHWGMFTYPKHQNCQEWERDVTEGGWSADYWVDEARKLGASYIVLATFHSRLG
YARPWPSKIPGSCATERDLLGELVAAGKAKGVNIILYMTDDPQWHNESGTETLDSAAYSA
YKGRQVDLTTRRGFGMFSYDLFSEVMENYPDLSGFWIDNDNEYWEEKGLYEQIRERRPDW
LLSNNNEDTPIMDTVSNEQKTGMTPAYDYPAAVTVPMPRLTEADYKLPTTGDWWYDGGDH
QVDARLSTGRYITNAGSSIKSLMAETPMVNGKLPPQQEEFNDFMGRWVEPIRESVYGVEG
GGYMYGGMQPGFWNDGAHGVVTVGRGEDGDRTQYVHVVTRPRTDLLRLRDNGYTVRRVTD
LRTGEAMRFSQSGGHLSVLGIRDWDPYDTVFKVETDGRQPYYKQSGVDATASSAGAGHPA
ADLADGNYETYWDSDGELPVSVTLDLGARKHATALAVNQREWSPTHARSSFGRPEDSARI
KDYRVYASGDGKRWTQVRAGALRSARGMQTIDIGDHDARYLKLEVRSLWGGPQAPEFFNQ
LRIDEIQVAYGRPKPTRTPLPLEAEARENRLTGAARFVECGACSGARRVVGLGGGLSNSV
TYRDVRAPEDGDYRLQLNHTAAATSSLSVSVNGAAPVEVPVVKGSPEVPESTAVSVPLKA
GANTVRIFSTAARGPGLDRIAVAPLPPASYTPKTTLTVRPHGLQWVGPGQRSITVTASLR
LDDDEQLDGVSLAPRLPAGWTADGGPVTARSLRLGQTLTGSWTLTSPPGQDAGSSDIPVT
ADFTLLGRQKSVSDPVRVRPLPDGRIWAREAEDSANQLGSTGITSCGPCSGAEKVRNIGG
SERAAVTFPGVVVPDGGQRTLYLDYTVNGTRSFHISVNGGPPTVVTVTDTGNTTPRTASV
PVTLKPGANTIKISNATESAPDLDRISLG
selected fasta
>[hypothetical protein]
ATGCCCACGCTGAGGATCCCGCTCCGCCCCCTACGCATCCGAGCAGCCCGAGCAGCCCGA
GCCGCGCGCACTTGGTGGCGCACCCTGTGCGCGGCACTCGTACTCGCCCTGGCCGTCGGC
CTTCTCACCGCCCCCGCGGCCGACGCCGAGGTCCAGCATCCGCGGCAGGAGTGGCTGCGC
GCGTCCACCGCCGGCCTCTTCCTGCACTGGGGCATGTTCACCTACCCCAAGCACCAGAAC
TGCCAGGAGTGGGAGCGCGATGTCACCGAGGGCGGCTGGAGCGCCGACTACTGGGTGGAC
GAGGCACGCAAGCTCGGCGCCTCGTACATCGTGCTCGCGACCTTCCACAGCAGGCTGGGC
TACGCCCGCCCCTGGCCCTCGAAGATCCCCGGCAGCTGTGCCACCGAGCGCGATCTGCTC
GGCGAACTGGTCGCCGCCGGCAAGGCCAAGGGCGTGAACATCATCCTCTACATGACCGAC
GACCCGCAGTGGCACAACGAGTCGGGCACCGAGACGCTGGACTCGGCCGCCTACTCCGCG
TACAAGGGCCGGCAGGTCGACCTGACCACGCGCCGCGGCTTCGGCATGTTCAGCTACGAC
CTGTTCTCCGAGGTCATGGAGAACTACCCGGATCTATCGGGCTTCTGGATCGACAACGAC
AACGAGTACTGGGAGGAAAAGGGCCTCTACGAGCAGATCCGCGAGCGCCGCCCTGACTGG
CTGCTGAGCAACAACAACGAGGACACGCCGATCATGGACACGGTCAGCAACGAGCAGAAG
ACCGGCATGACCCCGGCGTACGACTACCCCGCCGCCGTGACCGTCCCCATGCCACGGCTG
ACCGAGGCCGACTACAAGCTGCCGACCACCGGCGACTGGTGGTACGACGGCGGTGACCAC
CAGGTCGACGCCCGGCTCAGCACCGGCCGCTACATCACCAACGCCGGGTCCTCCATCAAA
TCGCTCATGGCCGAAACACCGATGGTGAACGGAAAACTGCCACCACAGCAGGAGGAGTTC
AACGACTTCATGGGCCGGTGGGTCGAGCCCATCCGGGAGTCGGTGTACGGCGTCGAGGGC
GGCGGTTATATGTACGGCGGTATGCAGCCCGGCTTCTGGAACGACGGCGCCCACGGCGTG
GTCACCGTGGGCCGGGGCGAGGACGGCGACCGCACCCAGTACGTACACGTGGTCACGCGG
CCGCGGACCGACCTGCTGCGGCTGCGCGACAACGGCTACACCGTGCGCCGCGTCACCGAC
CTGCGCACCGGCGAGGCGATGCGCTTCAGCCAGTCCGGTGGCCACCTGTCGGTCCTCGGC
ATCCGCGACTGGGATCCGTACGACACGGTGTTCAAGGTCGAAACCGACGGCCGTCAGCCC
TACTACAAGCAGTCCGGCGTCGACGCCACCGCCTCGTCCGCGGGCGCCGGACACCCGGCG
GCCGACCTCGCCGACGGAAACTACGAGACCTACTGGGACAGCGACGGCGAGCTGCCCGTC
TCCGTCACGCTCGACCTCGGCGCGCGCAAACACGCCACGGCGCTGGCGGTGAACCAGCGC
GAATGGTCCCCGACGCACGCACGGTCGTCCTTCGGCCGCCCCGAGGACTCCGCGCGCATC
AAGGACTACCGCGTCTACGCCAGTGGCGACGGCAAGCGCTGGACGCAGGTGCGCGCGGGC
GCGCTGCGCAGCGCCCGCGGGATGCAGACCATCGACATCGGCGACCACGACGCCCGCTAT
CTCAAGCTGGAGGTGCGCAGCCTGTGGGGCGGCCCGCAGGCGCCGGAGTTCTTCAACCAG
CTGCGCATCGACGAGATCCAGGTGGCGTACGGCCGCCCGAAGCCCACCCGCACCCCGCTG
CCGCTGGAGGCCGAGGCGCGGGAGAACCGGCTGACGGGCGCGGCCCGCTTCGTCGAGTGC
GGCGCCTGCTCCGGCGCGCGGCGCGTCGTCGGCCTCGGTGGGGGCCTGAGCAACTCCGTG
ACGTACCGCGATGTCCGGGCCCCCGAGGACGGCGACTACCGGCTCCAGCTGAACCACACG
GCGGCGGCCACCTCCTCCCTGTCCGTCAGCGTCAACGGCGCGGCGCCGGTGGAGGTGCCC
GTCGTCAAGGGCAGCCCTGAGGTGCCGGAGAGCACGGCGGTGTCCGTGCCGCTGAAGGCC
GGTGCCAACACCGTACGGATCTTCTCCACGGCCGCCCGCGGCCCCGGCCTCGACCGGATC
GCGGTCGCGCCCCTGCCCCCGGCCTCGTACACGCCCAAGACCACGCTCACCGTCCGGCCG
CACGGTCTGCAGTGGGTCGGCCCAGGCCAGCGGTCGATCACCGTCACGGCGTCGCTCCGG
CTCGACGACGACGAACAGCTCGACGGCGTCAGCCTCGCCCCGCGGCTGCCGGCCGGCTGG
ACCGCGGACGGCGGCCCGGTCACGGCCCGCTCGCTACGGCTCGGCCAGACCCTGACGGGC
AGCTGGACCCTCACCTCGCCACCCGGTCAGGACGCGGGCTCGTCCGACATCCCCGTCACG
GCGGACTTCACACTGCTCGGTCGGCAGAAGTCCGTCTCGGACCCCGTCCGGGTGCGGCCG
CTGCCCGACGGCCGGATCTGGGCGCGCGAGGCGGAGGACTCGGCCAACCAGCTCGGCAGT
ACGGGTATCACGAGCTGTGGACCCTGCTCCGGGGCCGAGAAGGTGCGCAACATCGGCGGC
AGCGAGCGGGCTGCCGTGACCTTCCCCGGCGTCGTCGTCCCCGACGGCGGGCAGCGCACG
CTCTACCTCGACTACACGGTCAACGGCACCCGCTCGTTCCACATCAGCGTCAACGGGGGC
CCGCCGACCGTGGTGACGGTGACCGACACCGGGAACACCACCCCGCGTACGGCCTCCGTC
CCCGTCACCCTGAAACCCGGCGCCAACACGATCAAGATCTCCAACGCCACCGAGTCCGCC
CCGGACCTCGACCGGATCTCCCTCGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000421 Coagulation factor 5/8 C-terminal type domain (Domain)
 [450-589]  PS50022
PS50022   FA58C_3
 [469-589]  3.3e-10 PF00754
PF00754   F5_F8_type_C
IPR000933 Glycoside hydrolase, family 29 (Family)
 [44-411]  2.79999889404114e-08 SM00812
SM00812   Alpha_L_fucos
 [46-357]  2.90000000000001e-17 PF01120
PF01120   Alpha_L_fucos
IPR005084 Carbohydrate binding module family 6 (Domain)
 [620-743]  PS51175 [867-989]  PS51175
PS51175   CBM6
IPR008979 Galactose-binding domain-like (Domain)
 [457-609]  3.59999643435987e-16 SSF49785 [619-746]  5.80000290670467e-08 SSF49785 [866-988]  2.19999900980708e-09 SSF49785
SSF49785   Gal_bind_like
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [44-356]  6.70000000000001e-23 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [42-356]  3.49999466863949e-25 SSF51445
SSF51445   Glyco_hydro_cat
IPR018905 Alpha-galactosidase, NEW3 domain (Domain)
 [774-844]  2.9e-08 PF10633
PF10633   NPCBM_assoc
SignalP
 [1-49]  1 Signal
Bacteria, Gram-positive   
 [1-49]  0.99 Signal
Eukaryota   
 [1-49]  1 Signal
Bacteria, Gram-negative   
TMHMM
 [25-47]  Transmembrane (i-o)
Transmembrane 1