close all open/close all

CDS information : Meili_00760


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction149,148 / 150,152 / + [in whole cluster]
149,148 / 150,152 / + [in contig]
Location149148..150152 [in whole cluster]
149148..150152 [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar-binding transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf67

close this sectionSequence

selected fasta
>[sugar-binding transcriptional regulator]
MPPNARSRRITIDDVARSAGVSRQTVSRAVNDKPEIDPATRQRVLEVAQAMGYRPSRFAR
GMVGPGLTTLGLVIADVLNPFFPEVVSGVLSAADERGWQVAIYSTGSALERESAVAATVV
DHVDACVAFLLDPAAIELVQRSGMPFVLLDNEHRPAAVSGGRIDFATGMRQAVGHLVERG
HRRIAMLDDRGRPDAGDRGTRHSLFLRAATECGLPADGGWVFPAANSLDGGAAAMDDVLD
TGFGATAVLAYNDLIAIGAMRRARDRGVSVPEDCAFVGCDGLTLSRLVDPPLTTLLVDKE
LLGRAAVQQVAALMTGAQARETVIVPRLVVRASS
selected fasta
>[sugar-binding transcriptional regulator]
GTGCCCCCGAACGCCAGGTCGCGCCGTATCACCATCGACGACGTGGCGCGTTCGGCCGGG
GTGTCCCGGCAGACCGTCTCCCGCGCGGTCAACGACAAACCGGAGATCGACCCCGCCACG
CGCCAGCGGGTGCTGGAAGTGGCCCAGGCCATGGGCTACCGCCCGAGCCGGTTCGCCCGC
GGCATGGTCGGCCCGGGGCTCACCACGCTGGGCCTCGTCATCGCGGATGTACTCAACCCC
TTCTTCCCCGAGGTGGTCTCCGGCGTGCTGTCGGCGGCCGACGAGCGCGGCTGGCAGGTC
GCCATCTACAGCACCGGGTCCGCCCTGGAACGCGAGAGCGCGGTGGCCGCGACCGTGGTC
GACCATGTGGACGCCTGTGTCGCCTTTCTGCTCGACCCGGCCGCCATCGAGCTCGTCCAA
CGCTCCGGTATGCCCTTCGTGCTGCTCGACAACGAGCACCGGCCGGCGGCGGTGAGCGGG
GGGCGGATCGACTTCGCCACCGGGATGCGCCAGGCGGTCGGCCATCTCGTCGAGCGTGGC
CACCGCCGGATCGCGATGCTCGACGACCGCGGGCGCCCGGACGCCGGGGACCGTGGCACC
CGGCACTCGCTGTTCCTCAGGGCCGCCACGGAATGCGGGCTGCCCGCCGACGGGGGGTGG
GTGTTCCCGGCCGCCAATTCCCTCGACGGTGGCGCGGCGGCCATGGACGACGTACTGGAC
ACCGGTTTCGGGGCGACGGCCGTGCTCGCGTACAACGACCTGATCGCCATCGGCGCCATG
CGCCGCGCCCGCGACCGCGGGGTGAGCGTGCCGGAGGACTGCGCGTTCGTCGGCTGTGAC
GGGCTGACCCTCAGTCGGCTGGTGGACCCACCGCTGACCACCCTGCTGGTCGACAAGGAA
CTCCTCGGCCGGGCCGCTGTGCAGCAGGTCGCCGCGCTGATGACCGGCGCCCAGGCGCGC
GAGACAGTGATCGTGCCGCGCCTCGTGGTACGCGCGTCTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [11-21]  4.39999967439747e-05 PR00036 [21-31]  4.39999967439747e-05 PR00036
PR00036   HTHLACI
 [9-79]  8.70001261213514e-27 SM00354
SM00354   HTH_LACI
 [10-64]  PS50932
PS50932   HTH_LACI_2
 [11-56]  9.20000000000002e-17 PF00356
PF00356   LacI
 [12-30]  PS00356
PS00356   HTH_LACI_1
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [8-66]  3.1999989904635e-18 SSF47413
SSF47413   Lambda_like_DNA
 [10-58]  4.29999999999998e-21 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP No significant hit
TMHMM No significant hit