close all open/close all

CDS information : Meili_00770


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction150,307 / 152,142 / + [in whole cluster]
150,307 / 152,142 / + [in contig]
Location150307..152142 [in whole cluster]
150307..152142 [in contig]
TypeCDS
Length1,836 bp (611 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf68

close this sectionSequence

selected fasta
>[monooxygenase]
MSGVPPTPPGLTPTDPERLGFDPEELRARYRAERDRRIRPDGRAQYQSTTGQFGYFEDDP
HAAQGITREPLRDRVEALVIGGGFGGLLAGARLRQAGVESIRVIEKGGDFGGTWYWNRYP
GIHCDIESYIYMPLLEEVGYVPKWRYAPGEEIRLHACAIARRFHLYDDVCFQTQATELRW
DEAESEWIVSTDRGDEIRARFVAVAGGTLSQPKLPGIPGIENFKGHTFHTSRWDYSYTGG
DAGGGLDKLADKRVALIGTGATAIQVVPHLGTDAQHLYVFQRTPSSVDARDNRPTDPKWA
GSLGPGWQRRRMENFLKVVTGVRADEDLVNDAWTSSARLYEKMIPTNSYAHIGPEERERA
YEIADFQKMNELRARVDALVEDPETAEKLKPWYRYMCKRPTFSDAYLQTFNRPDVTLVDT
ADTHGVERITENAVVVGGVEYDVDCIVFATGFEVGVSGVMSGKLPVYGRGGVSLMDSWKE
GPRTLHGFYSHGFPNLFQLGPVQNASAVNFVHVLDEQALHIAEVVAEARNRRARYIEPTV
TAQDQWVATIRQKAADLQKFHAECTPGYYNNEGQPRKRSESYGDGPVAFHELLRRWRGAD
GGMNDVLVEAE
selected fasta
>[monooxygenase]
GTGAGTGGTGTTCCCCCCACACCCCCCGGCCTCACCCCCACCGATCCCGAGCGACTGGGC
TTCGACCCGGAGGAGTTGCGGGCCCGCTATCGCGCCGAGCGCGACCGCCGGATCCGCCCC
GACGGCCGGGCCCAGTACCAGAGCACCACCGGCCAGTTCGGCTACTTCGAGGATGACCCT
CACGCCGCCCAGGGGATCACCCGCGAACCCCTGCGCGACCGGGTCGAAGCGCTGGTCATC
GGCGGCGGGTTCGGCGGCCTGCTCGCCGGGGCCCGGCTGCGCCAGGCCGGTGTGGAGTCG
ATCCGGGTGATCGAGAAGGGCGGCGACTTCGGCGGCACCTGGTACTGGAACCGCTACCCG
GGCATCCACTGCGATATCGAGTCGTACATCTATATGCCGCTACTGGAGGAAGTCGGATAC
GTCCCGAAGTGGCGGTACGCGCCGGGAGAGGAGATCCGGCTGCACGCCTGCGCCATCGCG
CGCCGCTTCCACCTCTACGACGACGTCTGCTTCCAGACGCAAGCCACCGAACTGCGCTGG
GACGAAGCCGAGTCGGAGTGGATCGTCTCCACCGACCGCGGTGACGAGATACGGGCGCGC
TTCGTTGCGGTGGCCGGCGGGACACTCAGCCAGCCCAAGCTTCCCGGCATACCAGGGATC
GAGAACTTCAAGGGGCACACGTTCCACACCAGCCGCTGGGACTACTCCTATACCGGAGGA
GATGCGGGTGGCGGCCTGGACAAGCTCGCCGACAAGCGTGTGGCCCTCATCGGAACGGGC
GCGACCGCCATCCAGGTCGTGCCACATCTGGGGACCGACGCGCAACACCTCTACGTATTC
CAGCGCACACCGTCCTCGGTGGATGCGCGCGACAACCGGCCCACCGACCCGAAGTGGGCC
GGGTCGCTCGGGCCGGGCTGGCAGCGGCGGCGCATGGAGAACTTCCTCAAGGTCGTCACG
GGCGTACGGGCCGACGAGGATCTGGTGAACGACGCCTGGACCAGCAGTGCCCGGCTGTAC
GAGAAGATGATCCCGACCAACAGCTATGCCCACATCGGGCCCGAGGAGCGGGAACGCGCC
TACGAGATCGCCGACTTCCAGAAGATGAACGAGTTGCGGGCCCGTGTGGACGCCCTCGTG
GAGGACCCGGAAACGGCGGAAAAGCTCAAGCCCTGGTACCGCTATATGTGCAAGCGGCCC
ACGTTCAGTGACGCCTATCTCCAGACCTTCAACCGGCCTGACGTCACCCTGGTGGACACG
GCCGACACCCATGGCGTGGAACGGATCACAGAGAACGCGGTGGTGGTCGGCGGGGTGGAG
TACGACGTCGACTGCATCGTCTTCGCCACCGGATTCGAGGTCGGTGTCTCGGGGGTCATG
TCCGGGAAGCTCCCGGTGTACGGCAGGGGCGGGGTGTCCCTGATGGACTCCTGGAAGGAG
GGTCCGAGGACACTCCACGGGTTCTACAGCCACGGCTTCCCCAACCTCTTCCAGCTCGGC
CCGGTGCAGAACGCCAGCGCCGTCAATTTCGTCCACGTCCTCGATGAGCAGGCGCTCCAT
ATCGCCGAGGTCGTCGCCGAGGCGCGCAACCGCCGGGCCCGGTATATCGAGCCAACGGTC
ACGGCGCAGGACCAATGGGTGGCGACGATCCGCCAGAAGGCCGCGGACCTGCAGAAATTC
CATGCCGAGTGCACGCCTGGCTACTACAACAACGAGGGGCAGCCGCGTAAGCGGAGCGAG
TCCTACGGTGACGGCCCGGTCGCGTTCCACGAGCTGCTGCGGCGCTGGCGTGGCGCGGAC
GGCGGGATGAACGACGTCCTCGTCGAGGCCGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit