close all open/close all

CDS information : Meili_00780


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction152,139 / 153,836 / + [in whole cluster]
152,139 / 153,836 / + [in contig]
Location152139..153836 [in whole cluster]
152139..153836 [in contig]
TypeCDS
Length1,698 bp (565 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf69

close this sectionSequence

selected fasta
>[hypothetical protein]
MKTEGSKKVDHDAMVSPSRFDETGRSRATSSRWEVRRLNPPNQLWGSNGVAFGPDGRLYV
AQFLAGQISAVDPATGDVEVIVPMDSPVQSPDDLAFGADGSMYITDLVPGRVWRRNAEGA
CTLVSDEVTNPNGITCIGDRLFINEMKPDGRLMELFPDGGGPVVLTEGLAMGNAMQLGPD
GHLYYPHMLSGQVWRIPPDGGTPEVVAEDVHQPVAVRFDQGGVLHVLSRGVEGIVTRIDV
HGAGSRALVHSGVVGLDNAAFDTENRMFLSSYASGGIMEMHSDGRTREIVPRGLDGPYGV
TVDLGGTVYAADHYRLASPAVSVETSREASRESALDDGPGAVTTAAFLCFSHGIAADGEL
LHLTSQYGDVHTYDPVHGTTRNRASGLKQPLGIAVGPDGSLVVAEAGAGRVVAIDDNGTV
TPLAEGLGHPVDVAFDEEGRCYVSDDRLGVVCRIDDGETVTVAGGLGAPQGLAVLGDELF
LVETDHRRLRAISLTTGETRIDAEDLPVGPPPGVVPRTQPALFAGGMPGMAIRFAGLAVA
PEGSLLLSANGEGTVLRLTPIRTGA
selected fasta
>[hypothetical protein]
ATGAAGACCGAGGGTTCCAAGAAGGTGGATCACGACGCGATGGTGTCACCCAGCCGGTTC
GACGAGACCGGCCGCAGCCGAGCCACCAGCAGCCGTTGGGAGGTGCGGCGGCTCAACCCG
CCCAACCAGCTGTGGGGTTCCAACGGTGTCGCCTTCGGACCCGACGGGCGGCTGTACGTC
GCCCAGTTCCTGGCCGGGCAGATCAGCGCCGTCGACCCGGCCACCGGGGACGTCGAGGTG
ATCGTGCCGATGGACAGTCCGGTCCAGTCACCGGACGACCTCGCCTTTGGGGCTGACGGC
TCGATGTACATCACCGATCTGGTCCCCGGCCGGGTGTGGCGCCGCAACGCCGAGGGGGCG
TGCACCCTCGTGTCCGACGAGGTCACCAACCCCAACGGCATCACATGCATCGGCGACCGG
CTCTTCATCAACGAGATGAAACCCGACGGCCGCCTGATGGAGCTCTTCCCGGACGGCGGT
GGCCCGGTGGTGCTCACCGAGGGGCTGGCCATGGGCAATGCGATGCAACTCGGCCCGGAC
GGCCATCTGTACTATCCGCATATGCTCAGCGGCCAGGTCTGGCGGATACCGCCGGACGGC
GGTACGCCCGAGGTGGTCGCGGAGGATGTGCACCAGCCGGTCGCCGTCCGCTTCGACCAG
GGCGGTGTGCTGCATGTGCTGTCGCGGGGCGTGGAAGGCATCGTGACCCGTATCGATGTG
CACGGCGCCGGGTCTCGGGCGCTCGTCCACAGCGGTGTGGTGGGCCTGGACAACGCGGCG
TTCGACACCGAGAACAGGATGTTCCTCTCCAGCTACGCCAGCGGCGGCATCATGGAGATG
CACTCCGACGGCAGGACCCGCGAGATCGTGCCACGCGGTCTCGACGGGCCCTACGGGGTG
ACGGTCGATCTCGGCGGCACGGTGTACGCGGCCGACCACTACCGGCTGGCGAGCCCCGCC
GTCTCCGTCGAAACGTCCCGGGAAGCCTCCCGGGAAAGCGCCCTCGACGACGGGCCGGGG
GCCGTGACCACGGCCGCCTTCCTGTGCTTCTCCCACGGGATCGCCGCCGACGGCGAGTTG
CTGCACCTCACCTCGCAGTACGGCGACGTCCACACCTACGACCCGGTGCACGGGACCACC
CGGAACCGGGCATCCGGTCTGAAGCAGCCTCTGGGCATCGCCGTGGGGCCGGACGGCTCG
CTCGTCGTCGCCGAGGCGGGCGCCGGCCGGGTCGTGGCCATCGACGACAACGGAACCGTC
ACCCCGCTCGCCGAAGGGCTCGGCCACCCCGTGGACGTGGCCTTCGACGAGGAGGGGCGC
TGCTATGTGAGTGACGACCGGCTCGGGGTGGTGTGCCGGATCGACGACGGGGAGACGGTG
ACCGTCGCGGGCGGGCTCGGGGCGCCGCAGGGCCTGGCGGTCCTGGGCGACGAACTGTTC
CTGGTGGAGACCGATCACCGCAGGCTCCGGGCGATCTCACTCACCACAGGGGAAACCAGG
ATCGACGCGGAGGACCTGCCGGTCGGACCGCCCCCGGGCGTCGTCCCCCGCACCCAGCCC
GCGCTGTTCGCCGGCGGCATGCCGGGAATGGCCATCCGGTTCGCCGGCCTCGCCGTCGCC
CCGGAGGGCTCCCTGCTCCTGTCGGCCAACGGCGAGGGCACCGTACTCCGGCTGACCCCG
ATCCGAACCGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011042 Six-bladed beta-propeller, TolB-like (Domain)
 [32-144]  1.99999999999999e-56 G3DSA:2.120.10.30 [150-313]  9.8e-58 G3DSA:2.120.10.30 [354-560]  7.09999999999991e-68 G3DSA:2.120.10.30
G3DSA:2.120.10.30   6-blade_b-propeller_TolB-like
SignalP No significant hit
TMHMM No significant hit