close all open/close all

CDS information : Meili_00790


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction154,052 / 167,044 / + [in whole cluster]
154,052 / 167,044 / + [in contig]
Location154052..167044 [in whole cluster]
154052..167044 [in contig]
TypeCDS
Length12,993 bp (4,330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
Gene
Gene (GenBank)meiA1
EC number
Keyword
Note
Note (GenBank)
  • similar to AVES 1
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionPKS/NRPS Module

0 malonyl-CoA for Meilingmycins A, B, D, and E
methylmalonyl-CoA for Meilingmycin C
1 methylmalonyl-CoA
not conserved YASHS(S->C)
2 malonyl-CoA
not conserved HAFHS(H->G)
AT93..411
ACP475..546
KS577..954
AT1113..1431
KR1753..1933
ACP2032..2102
KS2138..2517
AT2674..2998
DH3052..3224
ER3576..3882
KR3892..4072
ACP4175..4245

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MAGHPWILSGHTGTALRAQARRLHDHVADHPLLRPEDIAHTLASGGPALTHRAAVIAADR
EGYLRGLDAVARGEDAPGVVRGTATAVGDGVAFVFPGQGTQWPGMAADLLTVSPAFSRAV
DACAEAFEPYVPWSPEAVLRGAPGAPPLEGTDVVQPTLFAVMVGLAELWRTLGVSPTTIV
GHCIGEIAAAHLCGALSLSDAARVVIESSRAQATLSGSGALIAVARSEAQLLPLLRRWPG
RLTIAAVNGPMATVVSGDRPAADELLAELARAGVRAREVAIDIPAHSAFMAPLRDGLLDS
LSSVTAGASRLPFHSSVIGGPLETQGLDAAYWYRNLADTVRFESVVTGLLRQGTRCFVEL
SPHPMLTMCVQATAEEVVGGERVVILPTLHRGQAAVESVRTTLAELYVRGALDDPRAAFS
VPGGRLITLPLEPLADTSVELADAPDPAEACRPPWAERLARLSTAERKRRLCELVGVEAA
KVLEDVAGADAPRHGIAEQEHFVASGFDSAAAVALRNRLNDATGLLLPFTLAFDHPTPAA
VADHLHSRLFDHRGGGQPGADGWPDPAAAAGPARADDEPIAVIGMAGRFPGGARTPEELW
DLVAEGTDALSPFPEGRGWDPLRLYDPDPARPGTYYQREAGFLHDADKFDAEFFGIAPRE
ATAMDPQQRLLLETSWEALERARIDPTALRGSRTGVFVGVAPLDYSPRMHQASPELEGHL
LTGNIGAAASGRISYVLGLEGPAVSVDTACSSSLVALHLAAQALRAGECSLALVGGATVL
STPGMFIEFSRQRGLAPDGRCKAYAAAADGTGWSEGVGMLLVERLSDARRLGHQVLAVVR
GSAVNQDGASNGFTAPSGPSQQQVIRAALANAGVSAPEVDAVEGHGTGTRLGDPIEAQAL
LAAYGQGRAADRPLWLGSIKSNIGHTQWAAGVIGVIKMVLALQRGVLPRTLHVDKPSDYV
DWSAGAVRLLTEPVPWPERGHPRRAGVSSFGVSGTNAHVILEQATPSSTVAPEGPTAEAG
PPLPWVISAKTPQALRDQARRLHEHLTAQPQLQPADVGHTLATGRATFDHRAVLIGSDRE
QLLHGLDALATGRPDPAVHQTADRPATADGRIVFVFPGQGGQWAGMGLRLLNASPVFTER
MAACEQALSPYVDWSLTDILHRPADDAAWQRADIVQPALFSIMVSLAALWRSCGIEPDAV
LGHSQGEIAAAHVCGALTLHDAAKVIALRSQALQAVRGAGGMASVPLSADQVTEDLHTHW
PDRLWVAATNSPTATVISGNTDALDEALDHYHAHDVRAKRIPVDYASHCPHIDAVAERLP
DLLGGIVPRAADIPFYSTVDGRWAEPTELDADYWYRNLRSPVRFAHAVHALTEAEHRTFV
EVSPHPTLTPAITATAETTDRTTTVIASLHRDHEDAHHILTNLAQAHIHGHTVAWRHHYR
TLRPTPPHIDLPTYPFQHQHYWLHDSTEDKAVGTDLAAARFWEAVDGEDTNAVAALLDVE
PGTSLDALLPALSAWHGRRRDQAITDTWCYRDIWKPVDLTAARPRPSSRWLVAISAGRAD
HLHVSAVLDALERQGLPIATLVLDDTHIELPLLERHLAQVIASDGPAIGGVLSLLALDEG
PHPRHPEVPVGTALTLSLIQALIAREDIAPRLWLATHEAVATSSADTLDHPLQAMVWGLG
RTAALEHPDLWGGLIDLPDTLTERVLRGLVTALTTCHDEDELALRATGPRTRRLVRTPST
AAAEDTPPWTPRGTVLITGGTGALGSRVAHRIAERHPGCHLLLVSRRGANAPGATALRDQ
LIELGATVTLAVCDTADPGALADLLADVPSGRPLTAVVHTAGVLDDSTLAVQTPDHLAAV
LGPKSHAAHHLHALAQHHPLDAFVLFSSVAAPFGAAGQANYAAANAYLDALARHRRAQGL
AATSIAWGNWDGDGLASTQSAQTYLRNRGFPPMPPHLALAAMERAVVSPHAQLVVADVDW
KKLKPTPHTRDIPESRRPAPAATDGADRTADATASLRTRLAGQSPAERHQTLLDLISSHT
AAVLGHATPQTIPTDRAFRDLGFTSLTAIELRNRLAAATGLRLPTTVAFDRPTPDKLAAD
LLARCAPTGPDGIGVTADATAASGSSPGPAHGALDPAEPIAIVGWACRYPGGIGSPEDLW
EFVTAHRDAVGDFPTDRGWDLARLFDPDPDRPGTSYSRQGAFLHDAGDFDPEFFGISPRE
ATATDPQQRLLLETSWEALERAGINPHDLHGSPTGVFTGSNAQDFSARLRQTPSELAELC
EGYALTGSNNSVASGRVSYALGLEGPAVSIDTACSSSLVALHLACQSLRAGECSLALAGG
VTVMMTPFNFVEFSRQRGLAADGRCKAFSATADGTGWGEGVGMVVVERLSDARRNGHRVL
ALVRGSAVNQDGASNGLTAPNGPSQQRVIRAALAAAGVTAAEVDAVEAHGTGTTLGDPIE
AQALLATYGQGRPADRALWLGTVKSNIGHAQSAAGIAGVIKMVLALRHGMLPRTLHVSEP
SPHVDWSAGAVRLLTEDQPWPDTGRPRRAGVSSFGVSGTNAHVILEQAEPGPDPDPAPTA
SAHSVLPWPLSARSAEALRAQARRLRAYVAEHPDVDPADVGYSLARGRATFEHRAVLLGT
GHDDFRRGLDALVSGAPDGAVVQGAAVGRQGKVVFVCSGQGTQRPGMGRGLYRSSTAFAG
ALEEVCAHLDPYLEHPLMEVMFADEKSDTSALLHLTAYAQPALFALQTALHRMVTEEFGL
TPDYLAGHSLGELTAAHLAGILSLPDAAALVAARARAMRDLPAAGAMVAVEATEAELRPR
LAELAERVDIAAVNAPASLVITGDHGAVHQIADDFRAQGRKVTSLQVSGAFHSPHMEPLL
DEIGRTAETLTYHRPHTLLVTASADGGDDTIEPRADDDPGTAAFWPLQARRTVHYARAVE
RLHARGVTTFLELGPDATLTALVHHNLAAHDPVAVSLLHPERCETHSVLGALAAVHAHSR
PVDWTRHYTARPRPTPHQIDVPTYAFRHRRYWLPAPAAVGDVTAAGLDAAEHPLIGAAVG
LAEGDGCLLTGRISPRTHPWLADHVIVGTVLLPGTAFVELALRAGAYVGCGRVEELTLHA
PLPADGEVVLQVTVGAADESGRRELSIHARPADDGTWTRHAIGTLAPAHDVDAGQDGHAP
ADDGQFGSWATAWPPPGAEPLDVTGVYARFADAEFTYGEAFQGLVAAWRHGDETLAEVRL
PDQPAGDAHRFGLHPALLDAALQTMWLVEPDGTRPTGGLGGPDRGLPFAWQGVSLRTAGP
SALRVRLRRPAPDTVAVAVADPAGRPVASVESLTLRPVPRGALRGAEAAVRTSLHGLDWT
DVPLPTPPPARPRCALIGADTLGLGPALEAAAPDRITDGVERYADLEELVRSVAAGAPAP
DLVIATCHTAPEADGASEQPQPETVRTRTGQVLELLQRWLGADGLADAHLVLFTSGAVAT
RPGELVRDLAGAAVWGLVRSGQSEHPECFTVVDMDGAQESRAALLGALGLGEPQLAVRGG
RALAPRLVRPGAAADDSGLALPRGPEGWRLECPGTGSLDGLTTTESPAAAVPLGPGEVRV
AVRAAGLNFRDVLIALGVVPGRTALGSEGAGIVLEVGAEVRDLTPGDRVVGIFPEAFGPV
AVAERATLARIPDGWSFAQAASVPIVFATAYHGLVDLARLRPGESVLIHAAAGGVGMAAV
QLARHLGAEVYATAGPGKWHILRSQGIDDDHLASSRTLEFEQRFAATHGGRGIDVVLDCL
AHEFVDASLRLVARDGGRFLEMGKSDIRDPRQVALDHPGVLYRAFDLLEAGPERVGQILR
TVLDLFERGVLAHLPTTCWDIRQAEQAFRHLQQGRHIGKNVLTVPAGWNAEGTVLITGGT
GTLGAALARHLAGTGRARHLLLVGRRGPDAPGAEELREELTELGARVTIAACDLGDRAAV
ARLLGAIPAERPLTAVIHAAGVVDDATLGSLTPRHLDAALAAKADAAWHLHTLTRHADVA
AFVLFSSVAGLLGSPGQGNYAAANAFLDALAHHRRCSGLPAVSLAWGLWEQTSGMTGDLD
QADRARLARLGISPLTTGQALELFDTALGHHRPVLVPARLDVPDPHPGSSTVPPLYRGLV
GSRTRRTPPASAATGPFPLHTRLDGHAPAEQHEMLLSLVRSHAALVLGRDDPDTVHPGAH
FRGLGFDSLTAVELRNRLNAATGLRLSTTLVFDHPTPDELARHVREQVLGDGEAARVAPV
LAELDRLEAALSRVNGDDALRARVTARLQALLLKWNESDGPATGADGAGRLASATAAEVL
DFIRNDLGLS
selected fasta
>polyketide synthase [modular polyketide synthase]
GTGGCCGGACATCCGTGGATCCTCTCCGGACACACCGGAACCGCGCTGCGGGCCCAGGCG
CGCCGGCTCCACGACCATGTCGCCGACCACCCCCTGCTCCGTCCGGAAGACATCGCGCAC
ACGCTGGCGAGCGGCGGCCCGGCGCTCACCCATCGCGCGGCGGTGATCGCGGCGGACCGG
GAGGGATATCTCCGGGGGCTCGACGCGGTGGCCCGAGGTGAGGACGCCCCCGGTGTCGTA
CGGGGCACGGCGACCGCGGTCGGCGACGGGGTCGCGTTCGTCTTCCCCGGCCAGGGCACC
CAGTGGCCCGGTATGGCCGCGGATCTGCTGACGGTCTCCCCTGCCTTCAGCCGGGCGGTC
GACGCCTGCGCCGAGGCGTTCGAACCGTATGTCCCCTGGTCACCGGAGGCGGTGCTGCGG
GGCGCTCCGGGCGCGCCGCCCCTGGAGGGGACCGATGTGGTGCAGCCGACGCTGTTCGCC
GTCATGGTGGGGCTGGCCGAGCTGTGGCGGACTCTTGGGGTGAGCCCGACGACGATCGTG
GGGCACTGCATCGGGGAGATCGCGGCGGCCCATCTCTGCGGCGCCCTGTCGCTGTCCGAC
GCGGCGCGCGTGGTGATCGAGAGCAGCCGGGCCCAGGCGACGCTCTCCGGGTCGGGTGCG
CTGATCGCGGTCGCGCGGTCCGAGGCGCAGCTGCTTCCGCTACTGCGGCGGTGGCCGGGC
AGGCTGACGATCGCCGCGGTCAACGGCCCGATGGCCACGGTCGTCTCCGGCGATCGGCCG
GCCGCCGACGAGCTGTTGGCGGAGTTGGCCCGTGCCGGTGTCCGGGCCCGCGAGGTGGCG
ATCGACATCCCCGCGCACTCGGCGTTCATGGCCCCCCTCAGGGACGGTCTGCTCGACTCG
CTGTCATCGGTCACCGCGGGTGCGTCGCGGCTGCCGTTCCACTCCTCGGTCATCGGGGGG
CCGCTGGAGACCCAAGGGCTCGACGCGGCTTACTGGTACCGGAACCTCGCCGACACGGTC
CGCTTCGAAAGCGTGGTCACGGGGCTGCTGCGGCAGGGCACGCGCTGCTTCGTGGAGCTG
AGCCCGCATCCGATGCTGACCATGTGTGTGCAGGCCACCGCCGAGGAGGTGGTCGGCGGT
GAGCGCGTCGTGATCCTGCCGACGCTGCATCGCGGGCAAGCCGCCGTCGAGTCCGTTCGC
ACCACGCTGGCCGAGCTGTACGTACGGGGGGCGCTGGATGACCCTCGGGCGGCGTTCTCG
GTGCCGGGCGGCCGACTGATCACCCTGCCCCTCGAGCCGCTCGCGGACACGTCCGTAGAG
CTCGCCGACGCCCCGGATCCTGCGGAGGCCTGCCGGCCCCCTTGGGCGGAGCGGCTTGCC
CGGCTCTCCACCGCGGAGCGGAAGCGGCGGCTGTGCGAGCTGGTGGGCGTCGAGGCGGCC
AAGGTCCTCGAGGACGTCGCCGGGGCGGACGCGCCGCGCCACGGCATCGCTGAGCAGGAG
CACTTCGTCGCTTCGGGCTTCGACTCCGCGGCCGCGGTCGCGCTGCGCAACCGCCTGAAC
GACGCCACCGGACTGCTGCTGCCCTTCACCCTGGCCTTCGACCATCCGACACCCGCCGCC
GTCGCCGACCATCTGCACTCCCGGCTCTTCGATCACCGGGGCGGTGGGCAGCCGGGCGCC
GACGGCTGGCCCGACCCCGCGGCGGCGGCCGGTCCGGCCAGGGCCGACGACGAGCCGATC
GCCGTCATCGGCATGGCGGGCCGCTTCCCCGGGGGCGCTCGTACCCCGGAGGAGCTGTGG
GATCTGGTCGCCGAAGGCACCGACGCCCTCTCCCCCTTCCCGGAGGGCCGGGGCTGGGAT
CCGCTGCGGCTCTACGATCCGGACCCCGCCCGGCCCGGCACGTACTACCAGCGCGAAGCG
GGATTCCTCCACGACGCCGACAAGTTCGACGCCGAGTTCTTCGGCATCGCGCCACGCGAG
GCCACGGCCATGGATCCCCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGGCGCTCGAA
CGGGCGCGGATCGACCCGACCGCGCTGCGCGGCAGCCGCACCGGGGTGTTCGTCGGCGTG
GCCCCGCTGGACTACAGCCCCCGTATGCACCAGGCGTCGCCGGAGCTGGAGGGCCATCTG
CTGACCGGCAACATCGGCGCCGCGGCCTCGGGGCGGATCTCCTACGTACTCGGGCTCGAG
GGGCCCGCGGTGTCCGTGGACACGGCGTGCTCGTCGTCCCTGGTAGCCCTGCATCTGGCG
GCTCAGGCGCTGCGGGCCGGGGAGTGCTCGCTGGCCCTGGTCGGCGGGGCGACGGTCCTC
TCGACCCCCGGCATGTTCATCGAGTTCTCGCGGCAGCGCGGTCTGGCTCCGGACGGCCGC
TGCAAGGCGTACGCGGCCGCCGCGGACGGCACCGGCTGGTCCGAGGGCGTGGGCATGCTG
CTCGTCGAGCGGCTGTCCGACGCACGACGGCTCGGACACCAGGTGCTGGCGGTGGTACGG
GGCTCCGCCGTCAACCAGGACGGGGCGAGCAACGGCTTCACGGCGCCCAGCGGTCCATCA
CAGCAACAGGTCATCCGGGCGGCCCTGGCCAATGCGGGGGTGTCGGCTCCGGAGGTCGAC
GCGGTGGAGGGGCACGGCACCGGCACCCGGTTGGGCGATCCGATCGAGGCGCAGGCGCTG
CTGGCGGCGTACGGGCAGGGGCGGGCGGCCGACCGGCCGCTGTGGCTGGGCTCGATCAAG
TCGAACATCGGACACACCCAGTGGGCCGCGGGCGTCATCGGGGTCATCAAAATGGTGCTC
GCGCTCCAGCGCGGTGTGCTGCCGCGCACGCTGCACGTGGACAAGCCGTCGGATTACGTG
GACTGGTCGGCGGGGGCCGTACGGCTGTTGACGGAGCCGGTGCCCTGGCCGGAGAGGGGC
CACCCGCGCCGGGCGGGGGTGTCGTCCTTCGGCGTGAGCGGCACCAACGCCCATGTCATC
CTCGAGCAGGCAACGCCATCGTCCACGGTGGCTCCCGAGGGGCCTACCGCCGAGGCCGGG
CCTCCCCTGCCGTGGGTGATCTCGGCGAAGACCCCCCAGGCACTGCGCGACCAGGCCCGC
CGCCTGCACGAACACCTCACCGCCCAGCCACAGCTCCAACCGGCCGACGTCGGCCACACC
CTCGCCACCGGCCGCGCCACCTTCGACCACCGGGCCGTCCTCATCGGCTCCGACCGCGAA
CAACTCCTCCACGGCCTGGACGCGCTCGCCACCGGCCGGCCCGACCCAGCGGTCCACCAG
ACAGCGGACCGTCCCGCCACCGCCGACGGCCGTATCGTCTTCGTCTTCCCCGGACAAGGC
GGTCAATGGGCGGGCATGGGTCTACGGCTGCTGAACGCCTCACCCGTCTTCACCGAGCGG
ATGGCCGCCTGCGAACAGGCCCTCTCCCCCTACGTCGACTGGTCACTCACGGACATCCTC
CACCGGCCGGCCGACGACGCCGCATGGCAACGCGCCGACATCGTCCAGCCCGCCCTGTTC
TCGATCATGGTGTCCCTGGCCGCGCTCTGGCGCTCTTGCGGCATCGAACCGGACGCGGTC
CTCGGCCACTCCCAAGGCGAGATCGCCGCGGCCCACGTCTGCGGCGCACTGACGCTCCAC
GACGCGGCCAAGGTCATCGCCCTGCGCAGCCAGGCCCTCCAAGCCGTACGCGGCGCCGGG
GGCATGGCCTCCGTACCCCTGTCCGCGGACCAGGTCACCGAGGATCTGCACACCCACTGG
CCCGACCGGCTCTGGGTGGCCGCCACCAACTCCCCCACGGCAACCGTCATCTCGGGAAAC
ACCGACGCACTCGACGAAGCGCTCGACCACTACCACGCCCACGACGTACGGGCCAAACGC
ATCCCGGTCGACTACGCCTCCCACTGCCCCCATATCGACGCGGTGGCCGAGCGACTGCCC
GATCTGCTGGGCGGCATCGTCCCGCGCGCCGCCGACATCCCCTTCTACTCCACGGTTGAC
GGCCGATGGGCCGAGCCGACCGAGCTCGACGCCGACTACTGGTACCGCAACCTCCGCAGC
CCCGTACGGTTCGCCCACGCCGTCCACGCCCTCACCGAGGCCGAACACCGCACCTTCGTC
GAAGTCAGCCCACACCCCACGCTCACCCCCGCCATCACGGCCACCGCCGAAACCACCGAC
CGCACCACCACCGTCATCGCCTCGCTCCACCGCGACCACGAAGACGCTCACCACATCCTC
ACCAACCTCGCCCAGGCCCACATCCACGGCCACACCGTCGCCTGGCGACACCACTACCGG
ACTCTGCGCCCCACCCCGCCCCACATCGACCTCCCCACCTACCCCTTCCAACACCAGCAC
TACTGGCTCCACGACTCCACCGAGGACAAGGCGGTGGGTACGGACCTCGCTGCGGCCCGC
TTCTGGGAGGCAGTCGACGGCGAGGACACCAACGCCGTCGCCGCGCTCCTCGACGTCGAG
CCGGGCACCTCGCTGGACGCGCTGCTGCCGGCCCTGTCCGCCTGGCACGGTCGGCGTCGC
GACCAGGCCATCACCGACACCTGGTGTTACCGGGACATCTGGAAGCCGGTCGACCTCACC
GCCGCGCGCCCCCGACCGTCCAGCCGATGGCTTGTCGCGATCTCCGCAGGGCGGGCCGAT
CACCTCCACGTCAGTGCCGTCCTGGACGCTCTGGAACGCCAGGGTCTGCCCATCGCCACC
CTCGTCCTCGACGACACCCACATCGAACTCCCCCTGCTGGAGCGGCATCTCGCACAGGTG
ATCGCGAGCGATGGGCCGGCCATCGGCGGCGTGCTCTCGCTGCTCGCCCTCGACGAGGGG
CCACATCCGCGCCACCCGGAGGTGCCCGTCGGCACCGCCCTCACCCTCAGCCTGATCCAG
GCGCTCATCGCACGTGAGGACATCGCGCCCCGGCTCTGGCTGGCCACCCACGAGGCCGTC
GCCACCTCGTCCGCGGATACGCTCGATCACCCCCTCCAGGCGATGGTCTGGGGGCTGGGA
CGCACCGCCGCCCTCGAACACCCCGATCTGTGGGGCGGACTCATCGACCTTCCGGACACT
CTCACCGAACGGGTCCTCCGCGGCCTCGTCACGGCGCTGACCACCTGTCACGACGAGGAC
GAGCTCGCGCTGCGCGCCACCGGCCCACGCACCCGGCGGCTGGTCCGGACGCCGTCCACC
GCCGCGGCGGAGGACACCCCGCCGTGGACGCCCCGTGGCACCGTCCTCATCACCGGCGGC
ACCGGGGCCCTCGGCTCCCGCGTCGCCCACCGCATCGCCGAACGTCACCCCGGCTGCCAC
TTGCTGCTGGTGAGCCGGCGAGGGGCCAACGCCCCCGGCGCCACCGCGCTCCGCGACCAG
CTCATCGAACTCGGCGCCACGGTGACCCTCGCCGTATGTGACACCGCCGACCCCGGCGCG
CTCGCGGATCTCCTCGCCGATGTCCCCTCGGGCCGCCCTCTCACCGCGGTCGTCCACACC
GCGGGCGTCCTGGACGACAGCACCCTCGCCGTACAGACCCCGGACCACCTCGCCGCCGTT
CTGGGGCCCAAGTCCCATGCCGCACACCATCTGCACGCCCTCGCCCAGCACCACCCCCTC
GACGCGTTCGTCCTCTTCTCGTCCGTCGCGGCGCCCTTCGGTGCCGCGGGCCAGGCCAAC
TACGCGGCCGCCAACGCCTACCTCGACGCCCTCGCCCGGCACCGCCGGGCCCAGGGGCTG
GCCGCCACCTCCATCGCCTGGGGCAACTGGGACGGCGACGGGCTCGCGAGCACCCAGTCC
GCGCAGACGTACCTGCGCAACCGCGGCTTTCCTCCCATGCCGCCACACCTGGCGCTGGCC
GCCATGGAGCGAGCGGTCGTCTCGCCCCACGCCCAGCTCGTCGTCGCCGACGTCGACTGG
AAGAAGCTCAAGCCGACGCCGCACACCCGCGACATCCCGGAAAGCCGCCGCCCGGCCCCG
GCCGCCACCGACGGCGCAGACAGGACCGCCGACGCCACCGCGAGCCTCCGTACCCGCCTC
GCGGGTCAGAGCCCGGCCGAACGGCACCAGACGCTCCTCGACCTCATCAGCTCTCATACA
GCCGCCGTCCTCGGGCACGCCACGCCCCAGACGATCCCCACGGACCGGGCCTTCCGCGAC
CTGGGTTTCACCTCGCTGACGGCCATCGAGCTCCGCAACCGCCTCGCGGCGGCCACCGGG
CTCCGCCTGCCGACCACCGTCGCCTTCGACCGCCCGACGCCGGACAAGCTCGCGGCGGAC
CTGCTGGCGCGGTGCGCGCCGACGGGCCCGGACGGCATCGGAGTGACAGCCGACGCGACG
GCCGCGAGCGGCAGTTCGCCCGGTCCGGCGCATGGCGCGCTGGACCCCGCCGAGCCCATC
GCCATCGTCGGCTGGGCCTGCCGCTACCCCGGCGGGATCGGCTCCCCCGAGGACCTGTGG
GAGTTCGTCACCGCACACCGGGACGCCGTCGGAGACTTCCCGACCGACCGGGGCTGGGAC
CTGGCGAGGCTCTTCGACCCCGATCCGGACCGGCCGGGCACCTCGTACAGCCGACAGGGC
GCCTTCCTCCACGACGCGGGCGACTTCGACCCGGAGTTCTTCGGGATCAGCCCACGGGAG
GCGACGGCGACGGACCCCCAGCAGCGGCTGCTCCTGGAGACGTCCTGGGAAGCCCTCGAA
CGAGCCGGGATCAACCCGCACGATCTCCACGGCAGTCCGACGGGCGTCTTCACCGGCAGC
AACGCGCAGGACTTCAGCGCACGGCTGCGGCAGACGCCGTCGGAGCTGGCGGAGCTGTGC
GAGGGCTATGCGCTGACGGGCAGCAACAACAGCGTCGCCTCGGGGCGCGTCTCGTACGCG
CTCGGCCTGGAAGGCCCGGCGGTCAGCATCGACACCGCCTGCTCGTCCTCGCTCGTGGCG
CTCCATCTGGCCTGCCAGTCGCTCCGGGCCGGCGAATGCTCGCTTGCCCTGGCGGGCGGC
GTCACGGTCATGATGACCCCGTTCAACTTCGTGGAGTTCTCCCGGCAGCGGGGCCTGGCG
GCGGACGGCCGGTGCAAGGCGTTCTCCGCCACCGCCGATGGCACCGGCTGGGGCGAGGGC
GTGGGCATGGTGGTGGTGGAGCGGCTGTCGGACGCGCGGCGCAACGGCCATCGTGTGCTG
GCCCTGGTCCGCGGCAGCGCCGTCAACCAGGACGGTGCCAGCAATGGGCTGACTGCCCCG
AACGGCCCCTCGCAGCAGCGGGTCATCCGCGCCGCCCTGGCCGCCGCCGGGGTCACCGCG
GCAGAGGTGGACGCGGTCGAGGCGCACGGCACGGGGACGACGCTCGGCGATCCGATCGAG
GCCCAGGCCCTGCTCGCCACCTATGGGCAGGGGCGGCCGGCGGACCGGGCGCTGTGGCTC
GGTACGGTCAAGTCCAACATCGGACACGCCCAGTCGGCCGCCGGTATCGCCGGGGTCATC
AAGATGGTGCTGGCCCTGCGGCACGGGATGCTGCCGCGTACGCTGCATGTGTCCGAGCCG
TCGCCGCATGTGGACTGGTCGGCGGGTGCGGTACGGCTGCTGACCGAGGACCAGCCGTGG
CCGGACACCGGGCGCCCCCGGCGGGCGGGGGTGTCGTCCTTCGGCGTGAGCGGCACCAAC
GCCCATGTGATCCTGGAGCAGGCGGAGCCGGGGCCGGACCCGGACCCGGCGCCGACGGCC
TCCGCGCACTCCGTGCTCCCCTGGCCCCTCTCCGCCAGGTCGGCGGAGGCCCTGCGGGCC
CAGGCCCGTAGGTTGCGGGCGTACGTGGCCGAGCACCCGGATGTCGACCCCGCCGACGTG
GGGTACTCCCTCGCGCGCGGACGGGCCACCTTCGAGCACCGGGCCGTGCTCCTCGGCACC
GGCCACGACGACTTCCGGCGCGGCTTGGACGCCCTGGTGTCGGGCGCGCCCGACGGCGCG
GTCGTCCAGGGCGCGGCGGTGGGGCGGCAGGGCAAGGTCGTCTTTGTGTGCTCGGGGCAG
GGCACCCAGCGCCCCGGCATGGGCCGCGGGCTCTACCGCTCGTCCACGGCGTTCGCCGGG
GCGCTGGAGGAGGTGTGCGCCCATCTGGACCCGTATCTGGAACACCCTCTGATGGAGGTG
ATGTTCGCCGACGAGAAGAGCGATACGTCGGCGCTGCTGCATCTGACCGCCTACGCCCAA
CCGGCCCTCTTCGCCCTCCAGACCGCGCTGCATCGCATGGTCACCGAGGAGTTCGGGCTC
ACCCCCGACTATCTGGCCGGCCACTCCCTGGGCGAGCTGACCGCCGCCCATCTGGCGGGC
ATCCTCAGCCTGCCCGACGCCGCGGCGCTGGTTGCGGCCCGCGCCCGCGCCATGCGGGAC
CTTCCGGCGGCCGGAGCCATGGTCGCCGTCGAGGCCACCGAGGCCGAACTGCGGCCTCGG
CTCGCCGAGTTGGCGGAGCGGGTCGACATCGCCGCCGTCAACGCCCCCGCGTCCCTGGTC
ATCACCGGCGACCACGGCGCCGTGCACCAGATCGCCGACGACTTCCGCGCGCAGGGCAGG
AAGGTCACCTCCCTCCAGGTCAGCGGCGCCTTCCACTCCCCCCATATGGAGCCCCTGCTC
GACGAGATCGGGCGCACCGCCGAAACCCTCACCTACCACCGGCCCCACACTCTCCTCGTC
ACCGCATCGGCGGACGGCGGCGACGACACGATCGAGCCGCGGGCCGACGACGACCCGGGC
ACGGCCGCGTTCTGGCCTCTCCAGGCCCGGCGCACCGTGCACTACGCACGGGCCGTGGAG
CGGCTGCACGCCCGCGGCGTCACCACGTTCCTGGAACTCGGCCCCGACGCCACCCTCACC
GCCCTCGTCCACCACAACCTCGCCGCGCACGATCCCGTGGCTGTCTCCCTGCTCCATCCG
GAGCGGTGCGAGACGCACAGCGTCCTCGGCGCGCTCGCCGCGGTCCACGCCCACAGCCGC
CCCGTCGACTGGACGCGCCACTACACCGCACGGCCGCGGCCGACGCCACACCAGATCGAC
GTGCCCACCTATGCCTTCCGGCACCGGCGCTACTGGCTGCCCGCCCCGGCGGCGGTCGGC
GATGTGACGGCCGCGGGGCTCGACGCGGCGGAGCACCCGCTGATCGGCGCCGCCGTGGGG
CTCGCGGAGGGCGACGGCTGTCTGCTGACCGGCAGGATCTCGCCGCGTACGCACCCGTGG
CTGGCCGACCATGTCATCGTCGGCACCGTGCTGCTTCCGGGCACCGCGTTCGTGGAGCTG
GCGCTGCGGGCCGGGGCGTATGTGGGCTGCGGCCGTGTGGAGGAGCTGACCCTGCACGCG
CCGCTCCCCGCCGACGGTGAGGTGGTGCTCCAGGTGACGGTGGGGGCCGCCGACGAGTCC
GGCCGCCGTGAGCTGAGCATTCACGCCCGGCCGGCGGACGACGGTACATGGACACGGCAC
GCCATCGGCACGCTGGCACCGGCCCACGACGTCGACGCGGGTCAAGATGGCCACGCCCCG
GCGGATGACGGGCAGTTCGGGTCGTGGGCCACGGCCTGGCCGCCGCCCGGTGCGGAGCCC
TTGGACGTCACCGGGGTCTACGCCCGGTTTGCCGACGCCGAGTTCACGTACGGGGAGGCC
TTCCAGGGGCTGGTCGCGGCTTGGCGGCACGGCGACGAGACGCTGGCGGAGGTCCGCCTC
CCCGACCAGCCGGCCGGTGACGCCCACCGCTTCGGGCTGCACCCCGCGCTGCTCGACGCG
GCACTGCAGACCATGTGGCTCGTGGAGCCCGACGGCACACGGCCGACGGGTGGCCTGGGC
GGCCCCGATCGGGGCCTGCCGTTCGCCTGGCAGGGGGTCTCGCTGCGTACGGCGGGCCCG
TCGGCCCTGCGGGTACGGCTGCGACGGCCGGCGCCGGACACCGTGGCCGTCGCCGTGGCT
GACCCGGCCGGCCGACCGGTCGCGTCGGTGGAGTCGCTGACGCTGCGGCCGGTGCCGCGG
GGCGCCTTGCGCGGCGCCGAGGCGGCGGTGCGCACCTCGTTGCACGGCCTGGACTGGACG
GATGTGCCGCTGCCGACGCCGCCCCCGGCCCGGCCCCGGTGTGCGCTGATCGGAGCGGAC
ACGCTCGGCCTGGGCCCCGCGCTCGAGGCCGCGGCGCCCGACCGCATCACCGACGGCGTG
GAGCGCTACGCCGACCTGGAGGAGCTGGTGCGCTCCGTGGCGGCGGGCGCCCCCGCCCCG
GACCTCGTCATCGCCACCTGCCACACAGCCCCTGAAGCCGACGGCGCGAGCGAACAGCCA
CAGCCCGAGACGGTGCGCACAAGGACGGGTCAGGTGCTGGAGCTGCTTCAGCGGTGGCTC
GGCGCGGACGGGCTCGCCGACGCACACCTGGTGCTGTTCACCTCAGGCGCGGTCGCCACC
CGGCCGGGCGAGCTGGTGCGTGACCTGGCGGGGGCGGCCGTCTGGGGTCTGGTGCGCTCC
GGCCAGTCGGAGCATCCGGAGTGCTTCACCGTGGTGGACATGGACGGCGCCCAGGAGTCC
CGCGCGGCGCTGCTCGGCGCGCTCGGCCTCGGCGAGCCTCAACTGGCGGTGCGCGGCGGC
CGGGCGCTGGCGCCGCGCCTGGTGCGCCCGGGTGCCGCAGCCGACGACAGCGGCCTGGCC
CTGCCGCGGGGGCCGGAAGGCTGGCGGTTGGAGTGTCCCGGCACGGGCAGCCTGGACGGG
TTGACCACGACCGAGTCCCCGGCCGCGGCGGTGCCGCTCGGCCCGGGCGAGGTACGGGTC
GCGGTGCGGGCCGCGGGGCTGAACTTCCGCGATGTGCTGATCGCGCTGGGCGTGGTGCCC
GGGCGGACGGCGCTGGGCAGTGAGGGGGCGGGGATCGTCCTCGAGGTCGGGGCGGAGGTC
CGCGATCTCACGCCCGGGGACCGGGTGGTGGGTATCTTCCCCGAGGCGTTCGGCCCGGTG
GCCGTGGCCGAGCGGGCGACCTTGGCGCGGATCCCCGACGGCTGGTCGTTCGCCCAGGCC
GCGTCGGTCCCCATCGTGTTCGCCACCGCGTACCACGGCCTGGTCGATCTGGCGCGCCTG
CGGCCGGGGGAATCGGTGCTGATCCATGCCGCGGCCGGCGGGGTGGGCATGGCCGCCGTG
CAACTGGCGCGCCATCTGGGGGCCGAGGTGTACGCCACAGCCGGCCCCGGCAAGTGGCAC
ATCCTGCGCTCCCAAGGCATCGACGACGACCATCTGGCGTCGTCGCGCACGCTGGAGTTC
GAGCAGCGCTTCGCCGCGACCCACGGCGGGCGGGGCATCGATGTCGTCCTGGACTGTCTG
GCCCATGAGTTCGTCGACGCCTCGCTGCGCCTGGTGGCGCGTGACGGCGGCCGGTTCCTG
GAGATGGGCAAGAGCGACATCCGTGACCCGCGGCAGGTGGCGCTGGACCATCCGGGCGTG
CTCTACCGGGCGTTCGACCTGTTGGAGGCCGGGCCGGAGCGGGTCGGGCAGATCCTGCGC
ACCGTACTGGACCTGTTCGAGCGCGGTGTCCTGGCGCACCTGCCGACGACCTGCTGGGAC
ATCCGGCAGGCGGAGCAGGCCTTCCGCCATCTGCAGCAGGGCCGCCACATCGGAAAGAAC
GTGCTCACCGTCCCGGCCGGCTGGAACGCCGAGGGCACCGTACTGATCACCGGCGGTACG
GGCACCCTGGGTGCCGCCCTCGCTCGCCATCTGGCGGGTACCGGGCGCGCCCGCCATCTG
CTGCTGGTCGGCCGACGCGGCCCCGACGCCCCGGGCGCCGAGGAGCTGCGAGAGGAGCTG
ACCGAGCTGGGCGCGCGGGTCACCATCGCCGCATGCGATCTCGGCGACCGGGCGGCGGTC
GCCCGGCTCCTGGGGGCGATCCCGGCCGAGCGGCCGCTGACCGCCGTCATCCACGCGGCG
GGTGTCGTCGACGATGCCACCCTCGGGTCCCTCACCCCCCGCCACCTGGACGCCGCCCTG
GCCGCCAAGGCCGACGCCGCCTGGCATCTGCACACCCTCACCCGCCACGCCGACGTGGCC
GCGTTCGTCCTCTTCTCCTCGGTCGCCGGTCTGCTCGGCTCGCCCGGGCAGGGCAACTAC
GCCGCGGCCAACGCCTTCTTGGACGCGCTCGCCCACCACCGGCGCTGCTCTGGCCTTCCG
GCGGTGTCGCTGGCGTGGGGGCTGTGGGAGCAGACCAGCGGCATGACCGGAGACCTGGAC
CAGGCCGACCGCGCCCGGCTGGCCCGGCTCGGCATCAGCCCGCTCACGACCGGGCAGGCG
CTCGAACTTTTCGACACCGCCCTCGGCCACCACCGCCCCGTGCTCGTCCCCGCCCGCCTC
GACGTGCCCGACCCGCACCCCGGCTCGTCGACCGTGCCGCCCCTGTACCGGGGCCTGGTC
GGATCCAGGACCCGGCGGACACCCCCCGCGTCCGCCGCCACCGGGCCGTTCCCCCTGCAT
ACCCGCCTCGACGGTCACGCCCCGGCCGAGCAGCACGAGATGCTGCTCTCGCTGGTCCGC
TCGCACGCCGCTCTCGTGCTGGGCCGCGACGATCCGGACACGGTCCATCCCGGCGCGCAC
TTCCGCGGTCTGGGCTTCGACTCCCTGACCGCGGTCGAGCTCCGCAATCGGCTCAACGCC
GCCACCGGCCTCCGGCTCTCCACCACCCTCGTCTTCGACCACCCCACGCCCGACGAACTC
GCCCGTCACGTCCGGGAGCAGGTGCTGGGCGACGGCGAAGCGGCGCGGGTGGCCCCGGTG
CTGGCCGAGCTCGACAGGCTGGAGGCCGCGCTGTCCCGGGTGAACGGGGACGATGCGCTC
CGGGCGAGGGTGACGGCCCGGCTGCAGGCCCTTCTCCTGAAGTGGAACGAGTCCGATGGT
CCGGCGACGGGCGCAGACGGTGCGGGCAGGCTGGCGTCCGCCACGGCCGCCGAGGTGCTG
GATTTCATCAGGAACGACCTCGGCCTCTCCTGA
[0] AT93..411
[0] malonyl-CoA for Meilingmycins A, B, D, and E methylmalonyl-CoA for Meilingmycin C283..287
[0] ACP475..546
[1] KS577..954
[1] AT1113..1431
[1] methylmalonyl-CoA not conserved YASHS(S->C)1305..1309
[1] KR1753..1933
[1] ACP2032..2102
[2] KS2138..2517
[2] AT2674..2998
[2] malonyl-CoA not conserved HAFHS(H->G)2869..2873
[2] DH3052..3224
[2] ER3576..3882
[2] KR3892..4072
[2] ACP4175..4245
[0] AT277..1233
[0] malonyl-CoA for Meilingmycins A, B, D, and E methylmalonyl-CoA for Meilingmycin C847..861
[0] ACP1423..1638
[1] KS1729..2862
[1] AT3337..4293
[1] methylmalonyl-CoA not conserved YASHS(S->C)3913..3927
[1] KR5257..5799
[1] ACP6094..6306
[2] KS6412..7551
[2] AT8020..8994
[2] malonyl-CoA not conserved HAFHS(H->G)8605..8619
[2] DH9154..9672
[2] ER10726..11646
[2] KR11674..12216
[2] ACP12523..12735

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [82-215]  G3DSA:3.40.366.10 [283-400]  G3DSA:3.40.366.10 [1107-1236]  G3DSA:3.40.366.10 [1305-1421]  G3DSA:3.40.366.10 [2667-2801]  G3DSA:3.40.366.10 [2869-2989]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [3703-3724]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [4203-4218]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [464-594]  1.79999754022375e-17 SSF47336 [2025-2154]  8.40001703163684e-23 SSF47336 [4168-4266]  1.99999636034521e-23 SSF47336
SSF47336   ACP_like
 [483-545]  8.3e-08 PF00550 [2041-2099]  6.80000000000001e-08 PF00550 [4179-4244]  8.00000000000001e-14 PF00550
PF00550   PP-binding
 [481-549]  1.2e-57 G3DSA:1.10.1200.10 [2030-2105]  1.2e-57 G3DSA:1.10.1200.10 [4173-4248]  1.2e-57 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [475-546]  PS50075 [2032-2102]  PS50075 [4175-4245]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [3565-3710]  1.39999892049878e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3714-3812]  3.5e-14 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3595-3651]  1.4e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1753-1932]  4.39999999999997e-57 PF08659 [3892-4071]  8.89999999999994e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [577-828]  2.79999999999994e-93 PF00109 [2138-2392]  3.60000000000002e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [836-954]  2.70000000000002e-45 PF02801 [2400-2517]  2.19999999999997e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [93-411]  3.30000000000002e-87 PF00698 [1113-1431]  1.9e-105 PF00698 [2674-2998]  1.70000000000001e-51 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [90-377]  4.69998262513195e-55 SSF52151 [1111-1414]  8.70005082121738e-68 SSF52151 [2672-2996]  3.59998852907783e-55 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [217-282]  5.40000570248859e-15 SSF55048 [1238-1304]  1.29999924468179e-16 SSF55048 [2803-2868]  1.09999909120787e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [577-839]  G3DSA:3.40.47.10 [840-1006]  1.9e-128 G3DSA:3.40.47.10 [2140-2404]  G3DSA:3.40.47.10 [2405-2569]  1.9e-128 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [570-952]  8.00002659346736e-101 SSF53901 [2130-2516]  3.99998544139406e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1753-1939]  5.00000000000001e-71 G3DSA:3.40.50.720 [3711-3805]  2.7e-20 G3DSA:3.40.50.720 [3891-4075]  1e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [741-757]  PS00606 [2305-2321]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [94-393]  1.79999754022378e-89 SM00827 [1115-1413]  1.50000965748778e-116 SM00827 [2676-2982]  2.19999900980707e-94 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [476-549]  3.1999989904635e-19 SM00823 [2033-2105]  2.19999900980708e-29 SM00823 [4176-4248]  7.0999832511256e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3052-3224]  1e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [580-1006]  SM00825 [2140-2570]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1753-1933]  9.40003071030835e-54 SM00822 [3892-4072]  1.20000117458134e-59 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3576-3882]  SM00829
SM00829   PKS_ER
SignalP
 [1-20]  0.113 Signal
Bacteria, Gram-positive   
TMHMM No significant hit