close all open/close all

CDS information : Meili_00800


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction167,087 / 167,947 / + [in whole cluster]
167,087 / 167,947 / + [in contig]
Location167087..167947 [in whole cluster]
167087..167947 [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-5 O-methyltransferase
Product (GenBank)C5-O-methyltransferase
Gene
Gene (GenBank)meiD
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • similar to AveD
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>C-5 O-methyltransferase [C5-O-methyltransferase]
MTTASQNISPDHVADYYDRLTDLIGEAAGGNLHFGHWPHPHDGSPLGVAADRLTDHLIGK
LGDIAGRRVLDVGCGSGRPTVRLAQRAPTEVVGVTVSPVQIERATALAEREGVADRVRFI
RADAMALPFPDASFDAVWALECMFHMPSPAQVLGEIARVLRPGGRLAVMDVVLREPIASR
DRGVVERGRSMFAVPAHIELVEYPRLILGAGLRLEEMADLGDEIIRPSMEALGGAAAANS
AAYAAAFGVDTEQFDALVAEWARMNSSLQLGYVVLTAKRPGCPSES
selected fasta
>C-5 O-methyltransferase [C5-O-methyltransferase]
ATGACCACCGCATCGCAGAACATCTCCCCCGACCACGTGGCCGACTACTACGACCGTCTC
ACCGACCTGATCGGCGAGGCGGCGGGCGGCAACCTTCACTTCGGCCACTGGCCGCATCCG
CACGACGGAAGCCCCCTCGGGGTCGCCGCCGACCGGCTGACCGACCACCTCATCGGCAAA
CTCGGCGACATCGCCGGCCGCCGGGTCCTGGATGTGGGCTGCGGCTCCGGTAGGCCGACC
GTACGGCTGGCGCAGCGCGCGCCGACCGAGGTCGTCGGCGTCACCGTCAGCCCCGTACAG
ATCGAGCGGGCGACGGCGCTCGCCGAGCGGGAAGGGGTCGCCGACCGGGTGCGTTTCATC
CGCGCGGACGCCATGGCGCTGCCGTTCCCGGACGCCTCGTTCGATGCCGTGTGGGCGCTG
GAGTGCATGTTCCATATGCCCAGCCCCGCGCAGGTGCTGGGGGAGATCGCACGCGTGCTC
CGCCCCGGCGGGCGGCTCGCCGTCATGGACGTCGTGCTGCGGGAGCCGATCGCGAGCCGG
GACCGCGGCGTCGTCGAGCGCGGCCGCTCGATGTTCGCGGTCCCGGCCCATATCGAGTTG
GTGGAGTACCCCCGGCTGATCCTCGGCGCGGGCCTGCGGCTGGAGGAGATGGCCGACCTG
GGCGACGAGATCATCCGCCCGTCCATGGAAGCCCTGGGCGGTGCCGCCGCCGCCAACTCC
GCCGCCTACGCGGCGGCCTTCGGCGTCGACACCGAACAGTTCGACGCGCTTGTGGCGGAG
TGGGCGCGGATGAACTCGTCGCTCCAGCTCGGCTATGTGGTCCTGACCGCCAAGCGCCCG
GGATGTCCGTCCGAGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [70-167]  1.4e-26 PF08241
PF08241   Methyltransf_11
SignalP
 [1-1]  0.088 Signal
Eukaryota   
TMHMM No significant hit