close all open/close all

CDS information : Meili_00810


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction171,655 / 167,960 / - [in whole cluster]
171,655 / 167,960 / - [in contig]
Locationcomplement(167960..171655) [in whole cluster]
complement(167960..171655) [in contig]
TypeCDS
Length3,696 bp (1,231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf70

close this sectionSequence

selected fasta
>[hydrolase]
MPEENRSALSRRHMLGIMTAAAAGASLPLATAPSARAAGATTTGGHGSAPVDLRINSRIQ
PLGTQTAPTFGWVPPVDRQTAYEIQVGTAPGQADVWHSGKVAGSHSVDVAYGGGALRSEQ
PYFWRVRTWDEMGAPGRWSEPAKWETGLLRGEKDWSGALWIGGRQPQDHDWKDLTATVVF
RGGADPASGLSLLLRAEPIGKTWGEGLDWTIRQSGDEMQLTMKTSHYAGNTWVDDGTSEP
NWGVDFYDPQSETNPTTAGTRGVPIGTVTLPASTGLTKDTWASRDHTVRVTVRGLTVTTE
VGGVEVDRRTLTKDQIRRHGSFGFGGATSATVRSVTVTGTGAPDFSADLTTGANPFESGI
GTLDGLTFPPKNPYIPAKNAMLPIANPAPVLRRAFTLPRGRRIATARLHLSAAGNVTFTV
NGDPITVDGKQPAGDRTNVPRLLTDQSTYDRTVLYDTFDVTALLRAGRDNVLAAELGRGW
YGVTTPQEWYWQLAPYAGPPRLRAKLVVSYTDGSATTLVTDRDWLTADGPTTFDSVYSGE
KYDARRADRLGDWRSVGYRARGQWGPATALIPPGSCSGPAPKHHGALPATTVPEGFKPAA
LRAHEAEPVLVNQTLRPVSLTETAPGSGVWVLDYGQILTGFVRLSLTDVRPDKEGITLRI
RGGNRIAGGNGGAGSPLSVEEENFQHDANLQTHYYTVGKRPAQTWEQRFSHFGFRYLEVM
NLEAVLGRTPDLTRDADMLTVDVARSGFARTGTFTTDNALLNRLQRNLEWAEQNNLVQKP
TDTPSREKNGWTGDAMASSESQSLTWDVNAVLTNYLRHFPDTQISTGQLPMFVPIAKGGY
GYDHTPGWNAAWKAVPAWDSAYFVIPRELYAYYGNSSLFDELYDHQDTLLKYYETLFTAE
NHYTFEASLGAYSGAEPPGSNAVISLAFYIHFCDYMDEVGTRLGRTERAAHYAKLARTLR
RAFIANYWDASSGHFTQGSISSENALAIAFDLVPGSDLDADDPRHLAGTKTLAENKKALA
KLLADRIVAADHHIQNDMYGSRYEFNILSEYGYTDIALRAVTQTGAPGYVHQIAKGATSL
WEQWTDRLSVNHHYRSNVATWFYQSLAGIKPTATAYASLRIRPYVPSAAVNSRVPKDTQD
TDLAPATLDHVSASIDTVRGTVSSRWRRLPDGRIDLAVTIPYNTDAEIWVPTRNKPVTAP
RGVAFVRDDTSGGSPYQVYRARAGSYRFNAG
selected fasta
>[hydrolase]
GTGCCCGAGGAGAACAGAAGCGCGCTGAGCCGTCGACACATGCTCGGCATCATGACGGCG
GCGGCAGCCGGGGCCTCCCTCCCGCTCGCCACCGCACCCAGCGCCCGGGCGGCGGGCGCG
ACGACAACCGGCGGACACGGCTCCGCGCCCGTGGATCTGCGGATCAACTCCCGGATCCAG
CCCCTGGGGACACAGACCGCGCCGACGTTCGGCTGGGTGCCCCCGGTGGACCGGCAGACC
GCGTACGAGATCCAGGTCGGGACCGCACCCGGCCAAGCTGACGTCTGGCACAGCGGCAAG
GTCGCCGGCTCGCACAGCGTCGACGTGGCCTACGGCGGCGGCGCGCTGCGCTCGGAGCAG
CCGTACTTCTGGCGGGTGCGGACCTGGGACGAGATGGGCGCCCCCGGCCGCTGGAGCGAG
CCCGCGAAGTGGGAGACCGGCCTGCTGAGGGGCGAGAAGGACTGGTCGGGCGCGCTGTGG
ATCGGCGGACGCCAGCCCCAGGACCACGACTGGAAGGACCTGACCGCCACCGTCGTCTTC
CGCGGTGGCGCGGACCCGGCGAGCGGGCTGTCCCTGCTGCTGCGCGCCGAACCCATCGGT
AAGACCTGGGGCGAAGGGCTCGACTGGACCATCCGCCAGAGCGGCGACGAGATGCAGCTG
ACCATGAAGACCAGCCACTACGCCGGCAACACCTGGGTCGACGACGGCACATCCGAGCCG
AACTGGGGCGTCGACTTCTACGACCCGCAGAGCGAGACCAACCCCACCACCGCCGGCACC
CGCGGCGTCCCGATCGGCACGGTCACCCTCCCCGCCTCGACCGGGCTGACGAAGGACACC
TGGGCCTCCCGCGACCACACCGTGCGGGTCACGGTCCGCGGGCTCACCGTGACCACGGAG
GTGGGCGGTGTCGAGGTGGACCGCCGTACGCTCACGAAGGACCAGATCCGCCGCCATGGC
AGCTTCGGCTTCGGCGGCGCCACCTCCGCCACCGTCCGCAGCGTCACGGTGACGGGCACC
GGAGCCCCCGACTTCTCCGCCGACCTCACCACCGGCGCCAACCCGTTCGAGAGCGGCATC
GGCACCCTCGACGGCCTGACCTTCCCACCCAAGAACCCCTACATCCCCGCCAAGAACGCC
ATGCTGCCCATCGCCAACCCGGCACCGGTGCTGCGCCGCGCGTTCACGCTGCCCCGCGGC
CGGCGCATCGCCACGGCGCGTCTGCACCTGAGCGCCGCGGGCAACGTCACCTTCACCGTC
AACGGCGATCCGATCACCGTGGACGGCAAGCAGCCGGCCGGGGACCGGACCAACGTCCCC
CGGCTGCTCACCGACCAGAGCACCTACGACCGTACGGTGCTCTACGACACCTTCGACGTC
ACCGCGCTGCTCCGGGCCGGCCGGGACAACGTCCTCGCCGCCGAACTCGGCCGCGGCTGG
TACGGGGTGACCACACCACAGGAGTGGTACTGGCAGCTCGCCCCCTACGCCGGCCCGCCG
CGCCTGCGCGCCAAGCTCGTCGTGTCCTACACGGACGGCTCGGCCACCACGCTCGTCACC
GACCGGGACTGGCTCACCGCGGACGGGCCCACGACCTTCGACTCCGTCTACTCGGGCGAG
AAGTACGACGCCCGGCGCGCGGACCGGCTCGGCGACTGGCGCTCGGTCGGCTACCGCGCC
CGTGGCCAGTGGGGACCGGCCACCGCGCTGATCCCGCCGGGCAGTTGCTCCGGCCCCGCA
CCGAAGCACCATGGCGCGCTGCCCGCCACCACCGTCCCCGAGGGCTTCAAACCGGCCGCC
CTACGGGCCCACGAGGCGGAACCGGTCCTGGTCAACCAGACGCTGCGCCCGGTCTCGCTC
ACCGAGACCGCCCCCGGCTCGGGCGTCTGGGTCCTCGACTACGGCCAGATCCTGACGGGC
TTCGTCCGGCTGTCCCTCACCGATGTACGCCCCGACAAGGAGGGCATCACCCTGCGGATC
CGCGGGGGCAACCGCATCGCGGGCGGCAACGGCGGCGCAGGCTCCCCGCTGTCGGTCGAG
GAGGAGAACTTCCAGCACGACGCCAACCTCCAGACGCACTACTACACCGTCGGCAAGCGG
CCGGCGCAGACCTGGGAACAGCGGTTCAGCCACTTCGGCTTCCGCTACCTGGAAGTGATG
AACCTCGAAGCCGTCCTCGGCCGGACACCCGACCTCACGCGGGACGCGGATATGCTGACC
GTCGACGTGGCCCGCTCCGGCTTCGCCCGCACCGGCACGTTCACCACGGACAACGCCCTG
CTCAACCGACTCCAGCGCAATCTGGAGTGGGCCGAGCAGAACAACCTGGTCCAAAAGCCC
ACCGACACCCCCTCACGGGAGAAGAACGGCTGGACCGGCGACGCCATGGCCAGCTCCGAA
TCACAGTCCCTCACCTGGGACGTCAACGCCGTCCTCACCAACTACCTGCGCCACTTTCCC
GACACCCAGATCTCCACCGGCCAGCTGCCCATGTTCGTGCCCATCGCCAAGGGCGGCTAC
GGCTACGACCACACCCCCGGCTGGAATGCCGCGTGGAAGGCGGTGCCGGCCTGGGACTCG
GCGTACTTCGTCATCCCGAGGGAGCTGTACGCGTACTACGGCAACAGCAGCCTGTTCGAC
GAGCTCTACGACCACCAGGACACCCTTCTCAAGTACTACGAGACGCTGTTCACCGCCGAG
AACCACTACACATTCGAAGCATCCCTCGGCGCCTACTCCGGCGCCGAGCCCCCCGGCAGC
AACGCCGTCATCAGCCTCGCCTTTTACATCCACTTCTGCGACTACATGGACGAGGTGGGC
ACCAGGCTCGGCCGCACCGAACGCGCCGCTCACTACGCGAAGCTGGCGCGCACCCTGCGC
AGGGCCTTCATCGCCAACTACTGGGACGCCTCCTCGGGACACTTCACCCAGGGCAGCATC
TCCAGCGAGAACGCCCTGGCCATCGCCTTCGACCTGGTGCCCGGTTCGGACCTGGACGCC
GACGACCCCCGCCACCTGGCCGGCACCAAGACCCTCGCCGAGAACAAGAAGGCCCTCGCG
AAACTGCTTGCCGACCGCATCGTGGCAGCGGACCACCACATCCAGAACGACATGTACGGA
TCGCGCTACGAGTTCAACATCCTCAGCGAGTACGGCTACACGGACATCGCGCTGAGGGCC
GTCACCCAGACCGGTGCGCCCGGCTATGTCCACCAGATCGCCAAGGGCGCCACCTCGCTG
TGGGAACAGTGGACGGACCGCCTCTCGGTCAACCACCACTACCGCTCCAACGTGGCGACC
TGGTTCTACCAGAGCCTCGCCGGTATCAAGCCGACCGCCACCGCCTACGCGTCGCTGCGC
ATCCGCCCGTACGTACCGTCAGCCGCCGTCAACAGCCGGGTGCCGAAAGACACGCAGGAC
ACCGATCTGGCGCCCGCGACGCTCGACCACGTCAGCGCCTCCATCGACACCGTGCGCGGC
ACGGTGTCCTCGCGGTGGCGGCGCCTGCCGGACGGCAGGATCGACCTCGCGGTCACCATC
CCGTACAACACCGACGCCGAGATCTGGGTCCCCACCCGGAACAAGCCCGTCACCGCGCCC
CGGGGTGTCGCGTTCGTCCGCGACGACACCTCCGGGGGATCCCCCTACCAGGTCTACCGG
GCCCGGGCCGGCTCGTACCGCTTCAACGCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003961 Fibronectin, type III (Domain)
 [45-146]  1.10000029896148e-06 SSF49265
SSF49265   FN_III-like
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-37]  PS51318
PS51318   TAT
IPR008902 Bacterial alpha-L-rhamnosidase (Domain)
 [626-1189]  1.99999999999999e-96 PF05592
PF05592   Bac_rhamnosid
IPR008928 Six-hairpin glycosidase-like (Domain)
 [746-1191]  6.30000946287306e-23 SSF48208
SSF48208   Glyco_trans_6hp
IPR013737 Bacterial alpha-L-rhamnosidase N-terminal (Domain)
 [402-590]  1e-31 PF08531
PF08531   Bac_rhamnosid_N
SignalP
 [1-37]  1 Signal
Bacteria, Gram-negative   
 [1-37]  1 Signal
Bacteria, Gram-positive   
 [1-37]  0.924 Signal
Eukaryota   
TMHMM No significant hit