close all open/close all

CDS information : Meili_00820


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction172,498 / 171,713 / - [in whole cluster]
172,498 / 171,713 / - [in contig]
Locationcomplement(171713..172498) [in whole cluster]
complement(171713..172498) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)short-chain dehydrogenase/reductase SDR
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf71

close this sectionSequence

selected fasta
>[short-chain dehydrogenase/reductase SDR]
MSVQMRDAVAVVTGGGSGIGRATAHSLARRGARVVVTDRDGGRADAVAGELGERGIAAVC
DVTRLEDLQSVRDLALERFGRVDIVMNNVGILAVGPVEDIPLDAWQRVIDVNLLGIVRSN
LVFLPVLVEQGAGHVVNTASTAGLLPYGYEQMPYTATKHAVVGLSEALALYLRPRGIGVS
CLCPGVVATNIVEQVTFYGETSPPRGPNSPVLDAGTVGELVADGIAEDRFLILTVPEVAN
ELRERGADMDAYLSRLIADVM
selected fasta
>[short-chain dehydrogenase/reductase SDR]
ATGAGTGTGCAGATGCGCGACGCCGTAGCGGTGGTCACCGGAGGAGGCAGCGGGATCGGC
CGCGCCACGGCGCATTCGCTCGCCCGGCGCGGCGCCCGGGTCGTGGTCACCGACCGCGAC
GGCGGCCGGGCCGACGCCGTCGCCGGCGAACTCGGCGAGCGGGGCATCGCCGCGGTCTGC
GACGTGACCCGCCTGGAAGACCTCCAGTCGGTCCGCGACCTGGCGCTTGAGCGGTTCGGC
CGCGTCGACATCGTCATGAACAACGTGGGGATCCTCGCCGTCGGCCCCGTCGAGGACATC
CCCCTCGACGCATGGCAGCGTGTCATCGACGTCAACCTGCTGGGCATCGTGCGCAGCAAC
CTGGTCTTCCTGCCCGTACTCGTCGAACAGGGGGCCGGCCATGTGGTGAACACCGCCTCC
ACGGCGGGACTGCTGCCCTACGGATACGAGCAGATGCCGTACACCGCGACCAAACACGCG
GTGGTCGGGCTGTCCGAAGCGCTCGCCCTGTATCTGCGGCCACGGGGCATCGGGGTCTCC
TGTCTGTGCCCCGGGGTCGTGGCCACGAACATCGTGGAGCAGGTCACCTTCTACGGCGAG
ACATCGCCGCCACGCGGGCCGAACTCCCCGGTACTCGACGCCGGTACGGTCGGCGAACTC
GTCGCCGACGGCATCGCCGAGGACCGCTTCCTCATTCTCACGGTGCCGGAAGTCGCCAAC
GAACTGCGCGAACGCGGGGCCGACATGGACGCCTATCTGTCGCGTCTGATCGCCGACGTC
ATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [9-169]  1.69999999999999e-29 PF00106
PF00106   adh_short
 [80-91]  1.80000149287196e-09 PR00080 [133-141]  1.80000149287196e-09 PR00080 [154-173]  1.80000149287196e-09 PR00080
PR00080   SDRFAMILY
 [1-261]  5.40000570248859e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  1.39999892049878e-29 PR00081 [80-91]  1.39999892049878e-29 PR00081 [127-143]  1.39999892049878e-29 PR00081 [154-173]  1.39999892049878e-29 PR00081 [175-192]  1.39999892049878e-29 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-199]  6.40000000000004e-63 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-10]  0.102 Signal
Bacteria, Gram-negative   
 [1-28]  0.142 Signal
Bacteria, Gram-positive   
TMHMM No significant hit