close all open/close all

CDS information : Meili_00830


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction174,362 / 172,569 / - [in whole cluster]
174,362 / 172,569 / - [in contig]
Locationcomplement(172569..174362) [in whole cluster]
complement(172569..174362) [in contig]
TypeCDS
Length1,794 bp (597 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)beta-glucuronidase precursor
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf72

close this sectionSequence

selected fasta
>[beta-glucuronidase precursor]
MLKPRPTATRELVNLDGVWKFAVEGTVGETPWTGPLDTPLEAAVPASYNDLFTDSAIRDH
VGWVWYQRQVRVPRGWEGDRAILRVDAATHRGRVYVDGALVAEHIGGYTPFEADITDHIR
PGQEFRLTIGVNNELTNTTIPPGRITVSQDGRRTQTYLHDFYNYAGLARSVWLYSVPAVH
IADITVVTGLDGTTGTVDYEVTTSMTAPVRVRVLDPSGDEVAVSDGASGTLRIEDVTPWR
PGAAHLYDLVAEVMDAGDVVDTYAQPFGVRTVEVRGAQFLINGEPFYFTGFGKHEDTPVR
GKGHDDAYLVHDFQLMEWAGANSFRTSHYPYAEEVLDFADRHGIVVIDETAAVGLNLAVE
GGLTGAPVRPTFSPDTINDDTRAAHARAIRELIARDKNHPSVVMWCIANEPSSNEEGARE
YFEPLLELTRKLDPTRPVCYAAVMFATSDNDRIADLFDVLCINRYYGWYIATGDLATAER
YLEGDLRGWAAKFGKPIIMSEYGADTLQGLHSVWDQPWTEEYQAAYLAAYHRTFDRIEEV
VGEHIWNFADFQTSNGIHRVDGNRKGVFTRDRRPKAAARALRARWRGLDGRKPSSGA
selected fasta
>[beta-glucuronidase precursor]
ATGCTGAAGCCCCGCCCGACCGCCACCCGCGAACTGGTGAACCTCGACGGAGTCTGGAAG
TTCGCCGTCGAGGGGACCGTGGGCGAGACCCCATGGACCGGCCCGCTCGACACCCCGCTG
GAAGCCGCGGTCCCGGCCAGCTACAACGACCTGTTCACCGACAGCGCCATCCGCGACCAC
GTCGGCTGGGTTTGGTACCAGCGCCAGGTGCGAGTGCCGCGCGGCTGGGAGGGCGACCGC
GCCATCCTGCGGGTGGACGCCGCCACACACCGGGGGCGGGTGTACGTCGATGGCGCGCTG
GTCGCCGAACACATCGGCGGTTACACCCCGTTCGAGGCCGACATCACCGACCACATACGC
CCCGGCCAGGAGTTCCGGCTCACCATCGGCGTCAACAACGAGCTGACCAACACCACCATC
CCGCCCGGCAGGATCACCGTGAGCCAGGACGGCCGCCGGACCCAGACCTATCTGCACGAC
TTCTACAACTACGCCGGCCTCGCCCGGTCCGTATGGCTGTACAGCGTGCCCGCCGTGCAC
ATCGCCGACATCACCGTTGTGACCGGCCTCGACGGCACCACCGGGACGGTCGACTACGAG
GTCACCACCAGCATGACCGCCCCCGTACGCGTCCGTGTCCTGGATCCGTCGGGAGACGAG
GTCGCGGTGTCCGACGGTGCGAGCGGAACCCTGCGGATCGAGGACGTGACACCGTGGCGG
CCGGGCGCGGCCCATCTGTACGACCTCGTCGCCGAGGTCATGGACGCCGGCGACGTGGTG
GACACCTACGCCCAGCCCTTCGGCGTGCGCACGGTCGAGGTGCGCGGAGCGCAATTCCTC
ATCAACGGCGAGCCTTTCTACTTCACCGGCTTCGGTAAACACGAGGACACCCCGGTGCGC
GGCAAGGGCCACGACGACGCCTATCTCGTCCATGACTTCCAGCTGATGGAGTGGGCCGGC
GCCAACTCATTCCGCACCTCGCACTACCCGTACGCCGAGGAGGTGCTGGACTTCGCCGAC
CGGCACGGCATCGTCGTCATCGACGAGACGGCGGCCGTCGGCCTCAACCTGGCCGTCGAG
GGCGGACTGACCGGTGCTCCGGTGCGCCCCACCTTCTCGCCCGACACCATCAACGACGAC
ACCCGCGCCGCCCACGCCCGGGCGATCAGGGAGCTGATCGCCCGCGACAAGAACCATCCC
AGCGTCGTGATGTGGTGCATCGCGAACGAGCCGTCCTCCAATGAGGAGGGCGCGCGGGAA
TACTTCGAACCGCTCCTCGAACTCACCCGCAAGCTCGACCCCACCCGTCCCGTCTGCTAC
GCGGCCGTGATGTTCGCGACCTCCGACAACGACCGCATCGCCGACCTGTTCGACGTCCTG
TGCATCAACCGCTACTACGGCTGGTACATCGCGACGGGCGACCTGGCCACCGCCGAGAGA
TACCTGGAGGGCGATCTGCGCGGCTGGGCCGCCAAGTTCGGCAAGCCGATCATCATGAGC
GAGTACGGCGCCGACACTCTCCAGGGCCTGCACTCCGTATGGGACCAGCCGTGGACGGAG
GAGTACCAGGCCGCCTACCTGGCCGCGTACCACCGCACCTTCGACCGGATCGAGGAGGTC
GTCGGCGAACACATCTGGAACTTCGCCGACTTCCAGACCTCGAACGGCATCCACCGGGTC
GACGGCAACAGGAAGGGTGTCTTCACCCGCGACCGACGGCCCAAGGCGGCGGCCCGCGCG
CTGCGGGCGCGGTGGCGCGGGCTCGACGGCCGCAAACCGTCGAGCGGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006101 Glycoside hydrolase, family 2 (Family)
 [281-295]  2.30000440726534e-17 PR00132 [312-330]  2.30000440726534e-17 PR00132 [396-411]  2.30000440726534e-17 PR00132 [495-510]  2.30000440726534e-17 PR00132
PR00132   GLHYDRLASE2
IPR006102 Glycoside hydrolase, family 2, immunoglobulin-like beta-sandwich (Domain)
 [179-270]  4.1e-10 PF00703
PF00703   Glyco_hydro_2
 [179-271]  1.50000306971104e-20 SSF49303
SSF49303   Glyco_hydro_2Ig
IPR006103 Glycoside hydrolase, family 2, TIM barrel (Domain)
 [272-586]  2.50000000000001e-81 PF02836
PF02836   Glyco_hydro_2_C
IPR006104 Glycoside hydrolase, family 2, N-terminal (Domain)
 [10-177]  2.70000000000002e-35 PF02837
PF02837   Glyco_hydro_2_N
IPR008979 Galactose-binding domain-like (Domain)
 [1-178]  4.60000044330862e-49 SSF49785
SSF49785   Gal_bind_like
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [272-586]  2.09999999999996e-85 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR013812 Glycoside hydrolase, family 2/20, immunoglobulin-like beta-sandwich domain (Domain)
 [179-271]  9.40000000000003e-24 G3DSA:2.60.40.320
G3DSA:2.60.40.320   Glyco_hydro_2/20_Ig-like
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [272-588]  3.60002015031011e-87 SSF51445
SSF51445   Glyco_hydro_cat
IPR023230 Glycoside hydrolase, family 2, conserved site (Conserved_site)
 [322-347]  PS00719
PS00719   GLYCOSYL_HYDROL_F2_1
SignalP No significant hit
TMHMM No significant hit