close all open/close all

CDS information : Meili_00840


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction175,621 / 174,404 / - [in whole cluster]
175,621 / 174,404 / - [in contig]
Locationcomplement(174404..175621) [in whole cluster]
complement(174404..175621) [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)beta-glucosidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf73

close this sectionSequence

selected fasta
>[beta-glucosidase]
MTMTTRLVPCFLWGASTAPHQVEGNNLNSDWWASEQLLPGMELSGDAIDSYHRYAEDMRL
LADAGLTAYRFGIEWARIEPIPGEFSRAELAHYRRMIDTARQLGLEPVVTLHHFTNPKWF
VDEGGWMGERAIERFQAYIRAATSILDDVTWVCTMNEPNMLAIMVTMSRLVQATDAPAST
KEWMSPTVEGAARPVLPNPDPQIGRRLAEAHHAARDILKKHTDAAVGWTVACQALTPTPG
NEEILRELRYVREDLYLEAAREDDFIGVQSYSSQPVDENGIVPHPQGPDTTLTGNAYRPD
AIGIAVRHVWEATGGIPILVTENGIATADDERRIAYTKEAIGHLFAAIDDGIDIRGYLHW
SALDNFEWGHWEPTFGLVAVDRETFERHPKPSLAWLGEVARRGRL
selected fasta
>[beta-glucosidase]
GTGACCATGACGACCCGACTCGTGCCCTGTTTCCTCTGGGGCGCGTCCACCGCCCCCCAC
CAGGTGGAGGGGAACAACCTCAACAGCGACTGGTGGGCCAGCGAGCAGCTGCTGCCCGGC
ATGGAACTCAGCGGCGACGCGATCGACAGCTATCACCGCTACGCGGAGGACATGCGGCTG
CTGGCCGACGCGGGTCTGACCGCGTACCGCTTCGGCATCGAGTGGGCGCGTATCGAGCCC
ATTCCCGGCGAGTTCTCCCGCGCCGAACTCGCCCACTACCGCCGGATGATCGACACCGCC
CGGCAGCTCGGCCTCGAACCGGTGGTCACCCTGCACCACTTCACCAACCCCAAGTGGTTC
GTGGACGAAGGGGGCTGGATGGGGGAGCGGGCCATCGAGCGTTTCCAGGCGTACATCCGG
GCGGCCACGAGCATCCTCGACGACGTCACATGGGTCTGCACCATGAACGAGCCCAACATG
CTCGCGATCATGGTGACGATGAGCCGCCTCGTGCAGGCGACCGACGCGCCCGCGTCGACC
AAGGAGTGGATGAGCCCGACCGTCGAGGGCGCCGCGCGGCCGGTCCTGCCGAACCCCGAT
CCGCAGATCGGCCGACGACTCGCCGAGGCCCACCACGCGGCCCGCGACATCCTGAAGAAG
CACACCGATGCCGCCGTCGGCTGGACGGTGGCCTGCCAGGCCCTGACCCCGACCCCCGGC
AACGAGGAAATCCTCCGCGAACTGCGCTACGTCCGCGAGGACCTGTATCTCGAGGCCGCC
CGCGAGGACGACTTCATCGGGGTGCAGTCGTACTCCAGCCAGCCCGTCGACGAGAACGGC
ATCGTCCCGCATCCGCAGGGCCCGGACACCACGCTCACCGGCAACGCGTACCGGCCCGAC
GCGATCGGCATCGCGGTGCGGCACGTATGGGAGGCCACGGGCGGCATCCCGATCCTGGTC
ACCGAGAACGGGATCGCCACCGCCGATGACGAGCGGCGGATCGCCTACACCAAGGAGGCG
ATCGGGCATCTCTTCGCGGCCATTGACGACGGCATCGACATCCGCGGCTATCTCCACTGG
AGCGCCCTGGACAACTTCGAGTGGGGCCACTGGGAGCCCACGTTCGGCCTTGTCGCCGTA
GACCGCGAGACGTTCGAGCGCCACCCCAAGCCAAGCCTGGCCTGGCTGGGCGAGGTCGCG
CGCCGCGGGCGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001360 Glycoside hydrolase, family 1 (Family)
 [262-276]  2.2999993566538e-14 PR00131 [318-326]  2.2999993566538e-14 PR00131 [330-341]  2.2999993566538e-14 PR00131 [351-368]  2.2999993566538e-14 PR00131 [374-386]  2.2999993566538e-14 PR00131
PR00131   GLHYDRLASE1
 [10-178]  3.5e-35 PF00232 [289-401]  1.1e-20 PF00232
PF00232   Glyco_hydro_1
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [9-402]  1.10000000000001e-86 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [5-405]  8.19994104549873e-97 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-21]  0.734 Signal
Bacteria, Gram-negative   
 [1-20]  0.494 Signal
Bacteria, Gram-positive   
 [1-24]  0.974 Signal
Eukaryota   
TMHMM No significant hit