close all open/close all

CDS information : Meili_00850


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction176,493 / 175,618 / - [in whole cluster]
176,493 / 175,618 / - [in contig]
Locationcomplement(175618..176493) [in whole cluster]
complement(175618..176493) [in contig]
TypeCDS
Length876 bp (291 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ABC transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf74

close this sectionSequence

selected fasta
>[ABC transporter]
MTTARALLDVRDLRVAYPGRGRGFRARPQEVLHGVSLAVDEGETLGIVGESGSGKTTIGR
AVLGLVKPSGGHIGFLGQDITHRTAKERRALARHIQVVFQDPYSSLNPSLTIGDTLAEPL
VAQGARPRNARVRVRELLDQVGLPADASERLPREFSGGQRQRIAIARALAPGPKLIVCDE
PVSALDLSTQARVLDLFVDIQRRTGVAYLFVSHDLAVIRQVSHRVSVVYRGDVIETGPAG
RVTSTPEHPYTRRLLLAAPVANPVEQRKRREERQRRKAAERPVSSSTEEGK
selected fasta
>[ABC transporter]
ATGACGACGGCCCGGGCCCTGCTCGACGTGCGCGATCTGCGCGTGGCCTACCCGGGGCGC
GGGCGCGGATTCCGTGCCCGCCCGCAGGAGGTGCTGCACGGGGTGTCCCTGGCGGTGGAC
GAGGGCGAGACGCTGGGCATCGTCGGCGAGTCCGGATCCGGCAAGACGACCATCGGCCGG
GCGGTGCTCGGCCTGGTGAAGCCCAGCGGCGGACACATCGGCTTTCTCGGCCAGGACATC
ACCCACCGCACGGCCAAGGAGCGCCGCGCCCTCGCCCGCCACATCCAGGTCGTCTTCCAG
GACCCCTACTCCTCACTCAACCCGTCCCTCACAATCGGCGACACCCTCGCCGAGCCCCTG
GTGGCGCAGGGCGCGCGCCCACGCAACGCGCGGGTGCGCGTACGCGAGCTGCTGGACCAG
GTGGGGCTGCCGGCCGACGCCTCCGAACGGCTGCCGCGCGAGTTCAGTGGTGGCCAGCGC
CAGCGCATCGCGATCGCCCGGGCGCTGGCACCCGGGCCCAAGCTGATCGTGTGCGACGAG
CCGGTCTCCGCGCTCGATCTGTCGACGCAAGCACGCGTACTCGACCTCTTCGTGGACATC
CAGCGGCGCACCGGTGTCGCGTATCTCTTCGTCTCGCACGACCTCGCGGTCATCCGGCAG
GTGAGCCACCGGGTGAGCGTGGTCTACCGCGGCGACGTCATCGAGACCGGCCCGGCCGGC
CGTGTCACCTCCACCCCCGAACACCCCTACACCCGGCGCCTGTTGCTCGCCGCCCCCGTC
GCGAACCCCGTCGAGCAGCGGAAGCGGCGCGAGGAGCGGCAGCGTCGGAAGGCAGCCGAG
CGTCCGGTCTCCAGCTCTACGGAAGAAGGAAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [56-182]  4.5e-21 PF00005
PF00005   ABC_tran
 [8-255]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [41-232]  5.99999044089058e-18 SM00382
SM00382   AAA
IPR013563 Oligopeptide/dipeptide ABC transporter, C-terminal (Domain)
 [234-270]  1.9e-05 PF08352
PF08352   oligo_HPY
IPR017871 ABC transporter, conserved site (Conserved_site)
 [155-169]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit