close all open/close all

CDS information : Meili_00860


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction178,325 / 176,490 / - [in whole cluster]
178,325 / 176,490 / - [in contig]
Locationcomplement(176490..178325) [in whole cluster]
complement(176490..178325) [in contig]
TypeCDS
Length1,836 bp (611 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ABC transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf75

close this sectionSequence

selected fasta
>[ABC transporter]
MTAEHRTTQPRSVEHRTAAPGRRSPLRRLLTDPQAVISAGLLLTVVLLGQLSPLFTDHGP
NQASLDAVNAPVGTHGYPLGGDKSGRDIFARLLASINTSVVSALIGTSIALAIGVTFGLI
GGYYGRRVRGVTEWVFSLVMTFPGLLLLIVLLPVTGGDYRATMLIFGVLLSPGIYRLVRN
LVLGVKNELYVDAARVSGLSDRRILWRHVFSVVRGPVVIATAFLAGSSISVQSGLAFLGV
GSSTVPSFGAMISEGFSNLYEEPLQFLWPSLGLGTITASLVLLGNSLRDALDGGRPVPSR
IAPPERRPTAPTHTRPGSTPTGTSVAAPGLLTVEDLAIAYPTPTGELKEVVSGVTLTLEA
GQTLGLVGESGSGKTQTAFAVLGVLPAEAAITRGSIRLDGRELLGLDERALRAVRGTSIA
YVPQEPMSNLDPNFTVGAQLVEGLRASSPMTRREARTRVLALLDRVGIPDPRATYSSYPH
QISGGMAQRVLIAGAIASRPLLLIADEPTTALDVTVQAEILDLLRDLQREMNMAVLLVTH
NFGVVADSCDRVAVMRTGRIVETGDALDLFSAPRQEYTRMLLDSILDEHTLRTDRPAADT
SKTDTFETEAR
selected fasta
>[ABC transporter]
GTGACCGCCGAACACCGCACCACCCAACCCCGCAGCGTCGAACACCGCACCGCAGCCCCC
GGCCGCAGATCGCCGCTGCGCCGGCTGCTGACGGACCCGCAGGCCGTCATCAGCGCCGGC
CTCCTCCTGACCGTGGTCCTCCTCGGCCAACTCTCTCCGCTGTTCACCGATCACGGCCCC
AACCAAGCCTCCCTCGACGCGGTCAACGCCCCTGTCGGAACCCACGGCTACCCGCTGGGC
GGCGACAAGAGCGGGCGCGACATCTTCGCCCGGCTACTGGCCTCCATCAACACCAGCGTG
GTCTCCGCCCTCATCGGCACCAGCATCGCCCTGGCCATCGGCGTCACCTTCGGGCTCATC
GGCGGCTACTACGGCCGCCGCGTCCGGGGCGTCACCGAATGGGTCTTCAGCCTCGTCATG
ACCTTCCCCGGTCTGCTGCTGCTCATCGTGCTGCTGCCGGTGACGGGCGGCGACTACCGC
GCCACGATGCTGATCTTCGGCGTGCTGCTCTCACCCGGGATCTACCGCCTCGTACGCAAC
CTCGTTCTCGGCGTGAAGAACGAGCTCTACGTGGACGCCGCCCGCGTCTCGGGCCTGTCC
GACCGGCGCATTCTGTGGCGCCATGTGTTCTCCGTGGTCCGGGGCCCTGTCGTCATCGCC
ACCGCCTTCCTCGCCGGATCCTCGATCTCCGTCCAGTCGGGCCTCGCCTTCCTCGGCGTC
GGATCGAGCACGGTCCCCAGTTTCGGCGCGATGATCTCCGAGGGCTTCAGCAACCTGTAC
GAGGAACCACTGCAGTTCCTGTGGCCGAGCCTGGGGCTCGGCACCATCACCGCGTCCCTG
GTGCTGCTCGGCAACTCGCTCAGGGACGCGCTGGACGGCGGTCGGCCGGTGCCGTCCCGG
ATCGCCCCACCCGAGCGCCGGCCGACCGCGCCGACGCACACCAGGCCGGGTTCGACACCG
ACCGGGACCTCGGTGGCGGCTCCGGGGCTGCTCACCGTCGAGGACCTGGCCATCGCCTAC
CCGACACCGACAGGCGAGCTGAAGGAGGTCGTCAGCGGCGTCACCCTGACCCTGGAGGCG
GGGCAGACCCTCGGCCTGGTCGGCGAATCGGGATCCGGCAAGACCCAGACCGCGTTCGCC
GTCCTCGGTGTGCTGCCCGCCGAGGCGGCCATCACCCGCGGCTCGATCCGGCTCGACGGA
CGCGAACTCCTCGGCCTGGACGAGCGCGCACTGCGCGCCGTACGCGGAACCTCCATCGCG
TACGTACCGCAGGAGCCCATGTCCAACCTCGACCCCAACTTCACGGTGGGAGCACAGCTC
GTCGAAGGGCTGCGCGCGTCCTCGCCGATGACCCGGCGCGAAGCGCGCACACGCGTCCTC
GCCCTGCTGGACCGGGTCGGCATCCCGGATCCGCGGGCCACCTACTCCTCCTATCCGCAC
CAGATATCCGGCGGCATGGCCCAGCGCGTGCTCATCGCCGGCGCGATCGCGAGCCGCCCG
CTGCTGCTCATCGCCGACGAGCCCACGACCGCGCTCGACGTGACCGTGCAGGCGGAAATC
CTCGACCTGCTGCGCGACCTGCAGCGGGAAATGAACATGGCCGTGCTGCTCGTGACCCAC
AACTTCGGGGTGGTCGCCGACAGCTGCGACCGCGTCGCGGTCATGCGGACGGGACGGATC
GTCGAGACCGGCGACGCGCTCGACCTCTTCAGTGCGCCGCGGCAGGAGTACACCCGGATG
CTGCTGGATTCCATCCTCGACGAACACACCCTGCGCACCGACCGGCCCGCCGCGGACACA
AGCAAGACGGACACGTTCGAGACGGAGGCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [114-292]  2.6e-14 PF00528
PF00528   BPD_transp_1
 [96-288]  PS50928
PS50928   ABC_TM1
IPR003439 ABC transporter-like (Domain)
 [387-510]  3e-18 PF00005
PF00005   ABC_tran
 [331-582]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [360-567]  4.30000170645867e-15 SM00382
SM00382   AAA
IPR013563 Oligopeptide/dipeptide ABC transporter, C-terminal (Domain)
 [561-593]  0.00045 PF08352
PF08352   oligo_HPY
IPR017871 ABC transporter, conserved site (Conserved_site)
 [482-496]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [36-55]  Transmembrane (i-o) [99-121]  Transmembrane (o-i) [134-156]  Transmembrane (i-o) [161-183]  Transmembrane (o-i) [204-226]  Transmembrane (i-o)
Transmembrane 5