close all open/close all

CDS information : Meili_00870


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction179,278 / 178,322 / - [in whole cluster]
179,278 / 178,322 / - [in contig]
Locationcomplement(178322..179278) [in whole cluster]
complement(178322..179278) [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf76

close this sectionSequence

selected fasta
>[transporter]
MNRVMILYVLRRLTAGLVLAVLVTMITFLLLSTSFDDVASSVVGNGTTPARVQAQKAQMG
LDRPLFTQYLDWLSHAIRGDLGLSYFTSEPVRSALAARLGVTLSIVLAALLATTLISVVL
GVLAATRGGAVDRIAQGVSMVGYLVPNLLIAIALGYVLAVKLHWFPATGYTPLAENPAGW
ASTIAIPVVALMMSGVAGLTSQIRGAMIGELRKDYIRTLRTRGIPTRSIVLRHALRGAAG
PALTVLSLEFIQMLGGALIIEQVFALPGFGQYAFNASLQGDIPIIMGISLFGVLLVVCVN
LVVDLVNGWLNPKARVLQ
selected fasta
>[transporter]
TTGAACCGCGTCATGATCCTCTACGTGTTGCGCCGCCTCACCGCGGGCCTGGTGCTCGCG
GTCCTGGTGACCATGATCACGTTCCTGCTGCTGAGCACGTCGTTCGACGACGTCGCGAGC
AGCGTCGTCGGAAACGGGACGACGCCCGCCCGCGTCCAGGCCCAGAAGGCCCAGATGGGA
CTCGACCGCCCGCTGTTCACCCAGTACCTGGACTGGCTGTCCCACGCGATCCGCGGCGAC
CTCGGCCTCTCCTACTTCACCAGCGAGCCCGTCCGGTCGGCCCTCGCGGCCCGCCTCGGG
GTCACGCTGTCGATCGTGCTCGCCGCCCTGCTCGCCACCACGCTGATCAGTGTCGTGCTC
GGCGTCCTCGCCGCCACCCGCGGCGGCGCCGTCGACCGGATCGCCCAGGGCGTGTCGATG
GTCGGCTACCTGGTGCCGAACCTGCTGATCGCGATCGCCCTCGGCTACGTCCTGGCCGTC
AAGCTTCACTGGTTCCCGGCCACCGGCTACACCCCGCTGGCGGAGAACCCGGCAGGCTGG
GCCTCCACCATCGCCATCCCCGTCGTCGCCCTGATGATGAGCGGCGTCGCGGGCCTCACC
TCCCAGATCCGCGGCGCCATGATCGGCGAACTGCGCAAGGACTACATCCGCACCCTGCGC
ACACGGGGGATACCGACCCGGTCGATCGTGCTGCGCCACGCCCTGCGCGGCGCGGCCGGC
CCGGCGCTGACCGTGCTGTCCTTGGAGTTCATCCAGATGCTCGGCGGCGCCCTCATCATC
GAGCAGGTCTTCGCGCTCCCGGGCTTCGGCCAGTACGCCTTCAACGCGTCCCTGCAGGGC
GACATCCCCATCATCATGGGCATCAGCCTCTTCGGTGTGCTGCTCGTGGTGTGCGTCAAC
CTCGTCGTCGACCTGGTGAACGGCTGGCTCAACCCGAAGGCGAGGGTCCTGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [118-315]  7.79999999999999e-32 PF00528
PF00528   BPD_transp_1
 [99-303]  PS50928
PS50928   ABC_TM1
SignalP
 [1-32]  0.965 Signal
Bacteria, Gram-negative   
 [1-40]  0.624 Signal
Eukaryota   
 [1-41]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [13-35]  Transmembrane (i-o) [103-125]  Transmembrane (o-i) [138-160]  Transmembrane (i-o) [180-199]  Transmembrane (o-i) [242-264]  Transmembrane (i-o) [284-306]  Transmembrane (o-i)
Transmembrane 6