close all open/close all

CDS information : Meili_00880


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction180,837 / 179,275 / - [in whole cluster]
180,837 / 179,275 / - [in contig]
Locationcomplement(179275..180837) [in whole cluster]
complement(179275..180837) [in contig]
TypeCDS
Length1,563 bp (520 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)extracellular solute-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf77

close this sectionSequence

selected fasta
>[extracellular solute-binding protein]
MRIRHPHSRSHTRALAALGVAALVFTSSACGSESTGASSSSEATLALSIFGTPNSLAPTQ
LLEGQQTYVWDSIYDTLLIQDNKGELRPGAAKSWRYSGDARTLTLTLRTGMKFSTGTPVD
AAAVRTTLERIRTTPGPSQGVLASVASVEAPGATTVVIKLKQPDGSLLTSLSTAAGVIGD
PKTMNSKSAALNPVGSGPYTLDKGATVNGSVYVLKRRDDYWNKKAYPFRTVKVRVISDQT
AMANALKAGETNAGTVDVAQVSTFKSTGFETKHVQATAVATLVLGDRSGDVLKPLGDLRV
RKAINMAFDRAKMVKRLLRGSGRPTGQIFNPKGPGHAPALDQTYAYDPAAAKRLLAEAGY
PNGFSVTMPSLVVSKPFEPTFTQALADIGIKVTWQPVPAQQSVSALASKKYPMFLIVDGL
NTTPIEARNFYSPTGYRNVFNSTDPELAKLLDRANREVDPAKAADSYQAINKFGVENAWY
GPVFYIGSDWATKKGITYLGDGSSTMATIRQFGAADQARG
selected fasta
>[extracellular solute-binding protein]
ATGCGCATACGACACCCGCACTCGCGGTCCCACACTCGCGCCCTGGCCGCCTTGGGCGTC
GCCGCGCTGGTGTTCACATCGTCGGCGTGCGGCAGCGAGTCGACAGGAGCGTCCTCGTCC
TCGGAGGCGACGCTGGCACTCTCGATCTTCGGTACGCCCAACTCGCTCGCCCCCACCCAG
CTCCTGGAGGGGCAGCAGACCTACGTCTGGGACTCGATCTACGACACGCTGCTGATCCAG
GACAACAAGGGCGAGCTGCGGCCCGGTGCGGCAAAGAGCTGGCGCTACTCCGGCGATGCC
CGCACTTTGACCCTCACGCTGCGCACCGGCATGAAGTTCAGCACGGGCACCCCCGTCGAC
GCAGCCGCCGTACGGACGACGCTGGAGCGGATCAGGACGACGCCGGGGCCGAGCCAGGGG
GTGCTCGCCTCCGTCGCCTCGGTCGAGGCACCCGGCGCCACCACCGTCGTGATCAAGCTC
AAGCAGCCGGACGGCTCGCTGCTGACCTCGCTCTCCACGGCCGCCGGCGTCATCGGCGAC
CCCAAGACGATGAACTCCAAGAGCGCCGCGCTGAACCCGGTCGGCTCGGGCCCCTACACC
CTCGACAAGGGGGCGACGGTGAACGGGTCCGTGTATGTGCTCAAGCGGCGTGACGACTAC
TGGAACAAGAAGGCCTACCCCTTCCGGACCGTCAAGGTCCGAGTGATCTCCGATCAGACC
GCGATGGCCAACGCCCTGAAGGCGGGCGAGACCAACGCCGGCACCGTCGATGTCGCCCAG
GTCTCCACCTTCAAGTCGACGGGCTTTGAGACCAAACACGTCCAGGCGACCGCGGTGGCG
ACCCTGGTCCTGGGCGACCGCTCGGGGGACGTCCTCAAGCCGCTCGGTGATCTGCGGGTC
CGCAAGGCGATCAACATGGCCTTCGACCGCGCCAAGATGGTCAAGCGGCTGCTGCGCGGC
TCCGGCCGGCCGACCGGGCAGATCTTCAACCCCAAGGGACCGGGGCACGCCCCCGCACTG
GACCAGACATACGCCTACGACCCGGCGGCCGCCAAGCGGCTGCTGGCCGAGGCCGGTTAC
CCGAACGGCTTCTCCGTGACCATGCCGAGCCTCGTCGTCAGCAAGCCGTTCGAGCCGACG
TTCACCCAGGCGCTCGCCGACATCGGGATCAAGGTGACGTGGCAGCCCGTGCCCGCACAG
CAGAGCGTCTCCGCCCTCGCTTCCAAGAAGTACCCGATGTTCCTGATCGTCGACGGGCTG
AACACCACCCCGATCGAGGCGCGCAACTTCTACAGCCCCACCGGCTACCGCAACGTGTTC
AATTCCACCGACCCCGAGCTCGCGAAGCTGCTGGACCGGGCGAACCGGGAAGTGGACCCG
GCGAAGGCCGCGGACAGCTACCAGGCGATCAACAAGTTCGGGGTCGAGAACGCGTGGTAC
GGCCCGGTGTTCTACATCGGCAGTGACTGGGCGACCAAGAAGGGCATCACCTACCTCGGT
GACGGCTCCTCGACGATGGCCACCATCCGGCAGTTCGGCGCCGCCGACCAGGCCCGCGGT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000914 Bacterial extracellular solute-binding protein, family 5 (Domain)
 [85-438]  4.59999999999996e-67 PF00496
PF00496   SBP_bac_5
SignalP
 [1-37]  1 Signal
Bacteria, Gram-positive   
 [1-31]  0.989 Signal
Eukaryota   
 [1-31]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit