close all open/close all

CDS information : Meili_00890


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction181,085 / 181,693 / + [in whole cluster]
181,085 / 181,693 / + [in contig]
Location181085..181693 [in whole cluster]
181085..181693 [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)TetR-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf78

close this sectionSequence

selected fasta
>[TetR-family transcriptional regulator]
MSQAKARGPYAKTPARRAEIVRAARESFAENGYAKASLRDIAERAGITHAGLLHHFRNKD
ELLAEVLAGRDSEEWQHGASQVDSADRLAPYLGELIRHHQKAPELMRLWIELAAAASRPD
HPAHGYFVERYERGRAQFAEGLQDGAARGRLREDLSPESAAILFHAVLNGLQLQWVLDQD
LDIVGPVTDFVRLLFGHDQADE
selected fasta
>[TetR-family transcriptional regulator]
GTGAGTCAGGCAAAGGCGCGTGGTCCGTACGCCAAGACACCGGCCCGCAGAGCGGAGATC
GTACGGGCGGCGCGCGAGAGTTTCGCCGAGAACGGCTACGCCAAGGCATCCCTGCGCGAT
ATCGCGGAACGGGCCGGCATCACCCACGCCGGCCTCCTCCACCACTTCCGCAACAAGGAC
GAGCTCCTTGCCGAGGTGCTTGCCGGGCGCGACTCCGAGGAATGGCAGCACGGCGCGTCC
CAGGTCGACAGCGCGGACCGGCTCGCGCCCTACCTCGGCGAGCTCATCCGCCACCACCAG
AAGGCACCGGAGCTGATGCGCCTGTGGATCGAGCTCGCCGCCGCCGCCTCACGCCCGGAC
CACCCCGCCCACGGGTACTTCGTCGAACGCTATGAGCGCGGGCGCGCGCAGTTCGCCGAG
GGGTTGCAGGACGGAGCGGCCCGCGGCCGGCTGCGCGAGGACCTGAGCCCCGAGAGCGCC
GCGATCCTCTTCCACGCCGTGCTCAACGGGCTCCAACTGCAGTGGGTACTCGACCAGGAC
CTCGATATCGTCGGCCCCGTCACCGACTTCGTACGGCTGCTCTTCGGCCACGATCAGGCC
GACGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [20-33]  1.89999859865864e-10 PR00455 [41-64]  1.89999859865864e-10 PR00455
PR00455   HTHTETR
 [14-74]  PS50977
PS50977   HTH_TETR_2
 [20-66]  5.59999999999999e-18 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-92]  1.60000240695997e-18 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [82-195]  6.09999977126211e-22 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [6-184]  2.19999999999997e-40 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-23]  0.322 Signal
Bacteria, Gram-positive   
TMHMM No significant hit