close all open/close all

CDS information : Meili_00900


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction182,726 / 181,698 / - [in whole cluster]
182,726 / 181,698 / - [in contig]
Locationcomplement(181698..182726) [in whole cluster]
complement(181698..182726) [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)LacI-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf79

close this sectionSequence

selected fasta
>[LacI-family transcriptional regulator]
MDAAGRQRPTMADVADRAGVSRALVSIVFRNQPGASQETRERVLRVADEIGYRPDSAARL
LARGRSRTLGVMFTVHQTFHSDLIEGIYPEAERLGYDVLLSAAAEGRSEAKAVEALLGHR
CEALILLGPDVVPGYLDELRQRAVTVSVGHRVPRARVDFVHSAEAKGVRQAMDYLVELGH
RAIVHIDGGRGPGSAERRRSYRAAMRRRGLEPEIRVIPGEHTEQSGIETGQLLLAERDRG
LPLPTAVLAGNDRCAMGVWMALARGGVDVPRDISVVGYDDSHLSHLMPIGLTTVRQDAVL
MAEYAVRFAVERLENPELEPREAVLDPKLVVRGTSGPPPGAA
selected fasta
>[LacI-family transcriptional regulator]
GTGGATGCGGCGGGCAGGCAGCGGCCCACGATGGCCGATGTCGCCGACAGGGCGGGAGTG
TCCCGTGCGCTGGTCTCGATCGTGTTCCGCAATCAGCCGGGGGCGAGCCAGGAGACCCGT
GAGCGGGTGCTACGGGTGGCCGATGAGATCGGCTACCGCCCCGACAGCGCGGCCCGCCTC
TTGGCCCGTGGCCGCAGCCGCACGCTCGGCGTCATGTTCACGGTGCATCAGACCTTCCAC
AGCGACCTCATCGAGGGGATCTACCCCGAGGCCGAGCGCCTTGGTTATGACGTGCTGCTC
TCCGCGGCGGCCGAGGGGCGGAGCGAGGCCAAGGCGGTCGAGGCGTTGCTCGGCCACCGC
TGCGAGGCGCTGATCCTGCTCGGTCCCGATGTGGTCCCCGGCTATCTCGATGAACTCCGG
CAGCGCGCCGTCACCGTGTCGGTCGGCCACCGAGTGCCGCGCGCCCGCGTGGACTTCGTG
CACAGCGCCGAGGCGAAGGGGGTCCGGCAGGCCATGGACTACCTCGTCGAACTCGGCCAC
CGGGCGATCGTGCACATCGACGGCGGCCGGGGGCCCGGGTCGGCCGAGCGGCGGCGCTCC
TATCGGGCCGCGATGCGCCGGCGCGGACTGGAGCCGGAGATCCGGGTGATTCCCGGTGAG
CACACCGAGCAGTCCGGTATCGAGACCGGCCAACTGCTCCTCGCGGAGCGGGACCGGGGC
CTGCCCCTTCCGACGGCGGTCCTCGCGGGCAACGACCGGTGTGCCATGGGGGTGTGGATG
GCCCTGGCGCGGGGCGGTGTCGACGTTCCGCGCGATATCTCGGTCGTCGGTTACGACGAC
AGCCATCTCTCCCATCTCATGCCGATAGGGCTGACGACTGTTCGTCAGGACGCGGTGCTG
ATGGCCGAGTACGCCGTGCGGTTCGCCGTGGAGCGGCTGGAGAACCCGGAACTGGAGCCG
CGGGAGGCGGTGTTGGACCCCAAGCTCGTGGTGCGGGGGACCAGCGGGCCGCCGCCGGGG
GCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [10-55]  4.00000000000001e-14 PF00356
PF00356   LacI
 [9-63]  PS50932
PS50932   HTH_LACI_2
 [8-78]  1.10000150671642e-21 SM00354
SM00354   HTH_LACI
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [9-60]  2.2e-20 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
 [7-65]  6.39998633403535e-18 SSF47413
SSF47413   Lambda_like_DNA
SignalP No significant hit
TMHMM No significant hit