close all open/close all

CDS information : Meili_00910


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction182,934 / 183,905 / + [in whole cluster]
182,934 / 183,905 / + [in contig]
Location182934..183905 [in whole cluster]
182934..183905 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative carbohydrate kinase
Product (GenBank)carbohydrate kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf80
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
P42414
PmId
[18310071] myo-Inositol catabolism in Bacillus subtilis. (J Biol Chem. , 2008)

close this sectionSequence

selected fasta
>putative carbohydrate kinase [carbohydrate kinase]
MPFEVLTMGRVGVDVYPLQTGVGLAEVTSFGKYLGGSPTNVAVAAARYGRTSAVITKTGA
DPFGDFVRTALDGYGVDTRFVGTSDIAPTPVTFCEIFPPDDFPLYFYRLPKAPDLDIHPE
ELGLAAVRDARIFWVTGTGLSEEPSRTATLAALEHRAKAGTTVFDLDWRPMFWKSAAGGD
PAGARAYYAKALRHTTVAVGNLDECEVATGEREPYAAAKALLDAGVELAVVKQGPKGVLA
MDRDGSAVEVPPVPVEVVNGLGAGDAFGGALCHGLLSGWDTRRTVSFANAAGALVAGRLA
CSEAMPTEAEVAAALRETADDGR
selected fasta
>putative carbohydrate kinase [carbohydrate kinase]
ATGCCGTTCGAAGTACTGACCATGGGCCGCGTCGGAGTGGACGTGTATCCGCTCCAAACG
GGCGTGGGGCTGGCCGAGGTCACCTCGTTCGGCAAGTACCTCGGCGGCAGCCCGACCAAT
GTCGCGGTGGCCGCCGCCCGGTACGGGCGCACCTCGGCCGTGATCACCAAGACGGGCGCG
GACCCGTTCGGGGACTTCGTCCGCACGGCCCTGGACGGATACGGCGTCGACACCCGCTTC
GTCGGTACGTCGGATATCGCGCCGACCCCCGTGACCTTCTGCGAGATCTTCCCGCCGGAC
GACTTCCCGCTCTACTTCTACCGGCTGCCCAAGGCACCCGACCTGGACATCCATCCCGAG
GAGCTGGGCCTGGCAGCGGTGCGCGACGCCCGGATCTTCTGGGTCACCGGCACCGGGCTG
AGCGAGGAGCCGAGCCGTACGGCCACCCTCGCCGCGCTCGAGCACCGGGCGAAGGCGGGC
ACGACGGTGTTCGACCTCGACTGGCGGCCCATGTTCTGGAAGAGCGCGGCCGGGGGTGAC
CCCGCCGGGGCCCGTGCTTACTACGCGAAGGCCCTGCGCCACACCACCGTCGCCGTCGGG
AATCTCGACGAATGCGAGGTGGCGACCGGTGAGCGCGAGCCGTACGCCGCCGCGAAGGCG
CTGCTCGACGCCGGGGTGGAGCTGGCCGTGGTCAAGCAGGGCCCGAAGGGTGTGCTGGCC
ATGGACCGGGACGGCTCCGCCGTCGAGGTCCCGCCGGTGCCGGTGGAGGTGGTGAACGGC
CTGGGCGCCGGTGACGCGTTCGGTGGCGCGCTGTGCCACGGGCTGCTGTCCGGCTGGGAC
ACCCGGCGCACGGTGTCCTTCGCCAACGCCGCCGGTGCGCTCGTGGCCGGCCGCCTGGCC
TGCTCGGAGGCGATGCCGACCGAGGCCGAGGTGGCGGCGGCGCTGCGCGAGACGGCCGAT
GACGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011611 PfkB (Domain)
 [5-307]  2.1e-50 PF00294
PF00294   PfkB
SignalP No significant hit
TMHMM No significant hit