close all open/close all
Meili_00910 Meili_00910   last last

CDS information : Meili_00920


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction183,922 / 184,824 / + [in whole cluster]
183,922 / 184,824 / + [in contig]
Location183922..184824 [in whole cluster]
183922..184824 [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf81
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTKFSERCEDVLSDKVSRIVEARVSDPGAIAAAAERRVRATSLLGEHGKAMIIAADHPAR
GANGVGGDPTAMADRFELLDRLCTALERPGVTGVLATADILEDLLLLGVLDGKSVFGSMN
RAGLAGSVFEIDDRFTGYDAETIAAMGFDGGKMLTRIALEDPATPAALQNTARAVDELND
HRLVAMIEPFLSHWRDGRIHNDLTPDAVIKSITIASGLGRRTAHTWLKLPVVDDMERVLA
SSTLPALLLGGEVTDPDAAFASWGRALKLPTAQGLVVGRSLLYPTGGDVAAAVDRAVNLL
selected fasta
>hypothetical protein [hypothetical protein]
ATGACGAAATTCAGCGAGAGGTGTGAGGACGTGCTGTCCGACAAGGTGAGCCGTATCGTG
GAGGCCCGGGTCAGCGACCCCGGCGCCATCGCGGCGGCGGCCGAGCGGCGGGTGAGGGCC
ACCTCGCTGCTGGGTGAGCACGGCAAGGCGATGATCATCGCCGCCGACCATCCCGCGCGC
GGCGCCAACGGCGTCGGCGGCGACCCCACCGCCATGGCCGACCGATTCGAGCTGCTGGAC
CGGCTGTGCACCGCGCTGGAGCGGCCGGGTGTGACCGGTGTGCTGGCCACCGCCGACATT
CTGGAGGATTTGCTGCTGCTCGGGGTTCTCGACGGCAAGAGTGTCTTCGGCTCGATGAAC
CGGGCCGGTCTTGCGGGCTCGGTGTTCGAGATCGACGACCGCTTCACCGGCTACGACGCC
GAGACGATCGCCGCGATGGGCTTCGACGGCGGCAAGATGCTCACCCGTATCGCCCTGGAG
GACCCGGCGACCCCGGCTGCGCTGCAGAACACGGCCCGTGCGGTGGACGAGCTCAACGAC
CACCGTCTGGTGGCGATGATCGAGCCATTCCTCTCCCACTGGCGTGACGGCAGGATCCAC
AACGATCTGACCCCCGACGCGGTCATCAAGTCGATCACCATCGCCTCGGGGCTCGGTCGG
CGCACCGCCCACACCTGGCTCAAGCTGCCGGTCGTCGACGACATGGAGCGGGTGCTCGCC
TCCTCGACGCTGCCCGCGCTGCTGCTGGGCGGCGAGGTCACCGACCCTGACGCGGCCTTC
GCCTCCTGGGGCCGGGCCCTGAAACTCCCGACCGCGCAGGGCCTGGTCGTGGGCCGGTCC
CTGCTCTACCCCACGGGCGGCGATGTGGCCGCTGCCGTGGACCGGGCGGTGAACCTGCTG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013785 Aldolase-type TIM barrel (Domain)
 [37-295]  2.2e-28 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit
Meili_00910 Meili_00910   last last