close all open/close all
first first   Merid_00020 Merid_00020

CDS information : Merid_00010


close this sectionLocation

Organism
StrainDSM 4137
Entry nameMeridamycin
Contig
Start / Stop / Direction7,793 / 12,610 / + [in whole cluster]
7,793 / 12,610 / + [in contig]
Location7793..12610 [in whole cluster]
7793..12610 [in contig]
TypeCDS
Length4,818 bp (1,605 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)MerP
Gene
Gene (GenBank)merP
EC number
Keyword
  • L-pipecolate
Note
Note (GenBank)
  • non-ribosomal peptide synthetase
Reference
ACC
PmId
[17159202] Organization of the biosynthetic gene cluster in Streptomyces sp. DSM 4137 for the novel neuroprotectant polyketide meridamycin. (Microbiology. , 2006)
Related Reference
ACC
Q1WEL0
PmId
[16806745] Isolation and characterization of meridamycin biosynthetic gene cluster from Streptomyces sp. NRRL 30748. (Gene. , 2006)
ACC
Q54298
NITE
Rapam_00130
PmId
[9266694] The pipecolate-incorporating enzyme for the biosynthesis of the immunosuppressant rapamycin--nucleotide sequence analysis, disruption and heterologous expression of rapP from Streptomyces hygroscopicus. (Eur J Biochem. , 1997)
ACC
Q9KID8
NITE
Asco_00160
PmId
[15835888] Elucidating the substrate specificity and condensation domain activity of FkbP, the FK520 pipecolate-incorporating enzyme. (Biochemistry. , 2005)

close this sectionPKS/NRPS Module

15
16
C40..338
A524..967
PCP1056..1123
C1144..1437

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [MerP]
MGHSGAPKSRGLSAAMSNLFERTRRNESTGIVPVDRGRELRASFAQQRLWFLDQLEPGNA
SYNLPFAVRVRGRLDIPHLSRALSLVVARHEALRTTFGEAGGQPVQRIQPPAPVPVRLEP
VPGDSEEERLAEVRRLAGAEITEPFDLSTGPLLRAKALRLDEHDHVLLLTVHHVATDAWS
QGIVVRELSAAYEALDAGREPVLPPLPVQYADYAEWERDWLSGPTLRRQLDYWTKRLDGM
APALELPTDRPRPSVARQEGDAVRWELPAELIRAARRLGAGENATLYMTLLAAFQLVLGR
YVDSDDITVGTPVANRGRAEVEGLIGFFVNTVVLRTDLSGDPTFRQLLGRVRDMAAGAFA
HGDLPFEYLVEQVHPERDLSRNPLVQVLFQMINVPAERLALPGARTEPYDHGGILTRMDL
EVHLVEIEDGVLGHIVFSKALFDTSTIERLLHHVTVVLRGVLAEPDRCISEISPLDEAER
TKVLEEFNATTGPVPAGSLPALFTAQVERRPDAVAVISGGDRVTYAELDQRANQLAHLLA
GRGVGPEALVGLCVDRGIEMIVAILAILKLGAAYVPIDPNHPRGRVQFVLADAGVTVAVT
QQRFTGLLETPEAPGKPEVSGTHGVPGAAPGAPDAPEASGTPDAPGTPGIRLILLDAERE
PLAGQPRTPPTARPSAQNLAYVIYTSGSTGVPKGILMPATCVLNLVAWQKKALPIGPDAK
TAQFAMLTFDISLQEIFSALLYGETIVVPGEELRMDPVEFATWVHTNEIDQLFVPNVMLR
AISEEVDPHGTELAALRHLSQAGEPLSLHHDLRELCAHRPELRLHNHYGPSEAHVVTSYS
LPAEVAEWPLTAPIGRPIGNTRVYVVDRRLRPVPVGVPGELCVAGEGLARGYLGRPDLTA
ARFVADPFRGDGSRMYRSGDLVRWLPDGNLEFLGRIDDQVKIRGFRIEPGEIEAILARHQ
DVLHTAVMVREDTPADKRLVAYVVADATAADRPGRLTETLRRYVESAVPEYMVPSAFVLL
DTMPVTSGGKIDRKALPAPDLRTVLEVGYVAPRTPEEEAVCRVYTDLLGATRVGIDDDFF
ALGGHSLIATRVVARLRSALGIAVPLKAVFQQRTPRQLAATLTAAARSGPEPELPPLIPT
RRDQPIPLTFAQQQTDLFFGDVLDAGHWNIPMAVRVSGELDLDCLRRAMDLLIDRHEALR
TAFVRETDRYVQVIRPSAPVQVEVAEARDEAEASVLAGQEAARPFDLTRGPLARLRVLRL
AESDHVLVLTLHHLVTDGWSQGVLVRDLSIVYAALLRGTEPDLPPVPVQYADVASWERKW
LHGPLLRRQLDFWKRHFAGMAPAELPTDRPRAASARYESDIFRWRLPKDAVETARRLGES
SNATLYMTLLTALKVVMSARSDNQDVLVGVPTANRGRDELENTVGLVSKMLALRTEVSGA
TDFGTLLATVRDAMSDAHTHQDVPFVSVLKHIGEHTGGLGGGPAGEHTDDRVGGRAGTRL
SDDPPVKVIFQIVNTPPRPLRLTGLTAEPFLMTHPPVTVNVDMEIDLYESAEDGGLAGTV
LYSKSLFDRATIERFCDDVVAVVSTAAADPGRPVSQVWQGRGRDQ
selected fasta
>non-ribosomal peptide synthetase [MerP]
GTGGGGCATTCAGGCGCGCCCAAATCCCGTGGTCTCAGCGCGGCCATGAGCAATCTCTTC
GAGCGGACCAGGAGAAACGAATCCACCGGCATTGTGCCGGTCGACCGGGGCCGGGAGCTG
AGGGCGTCGTTCGCCCAGCAACGGCTGTGGTTTCTCGACCAGTTGGAACCCGGCAACGCC
TCGTACAACCTCCCCTTCGCGGTGCGGGTGCGCGGCCGCCTGGACATCCCTCATCTCTCC
CGGGCCCTTTCGCTCGTGGTCGCCCGGCACGAGGCGCTGCGCACCACCTTCGGCGAGGCC
GGCGGTCAGCCGGTGCAGCGGATCCAGCCCCCCGCCCCCGTCCCGGTGCGCCTCGAACCG
GTGCCCGGCGACTCCGAGGAGGAGCGGCTGGCCGAGGTCCGGCGGCTGGCCGGAGCCGAG
ATCACCGAGCCCTTCGACCTGAGCACCGGACCCCTGCTGCGAGCCAAGGCGCTGCGACTG
GACGAACACGACCACGTCCTGCTGCTCACGGTGCACCATGTGGCGACCGACGCCTGGTCA
CAGGGCATTGTGGTGCGTGAGCTGTCCGCCGCGTACGAGGCGCTGGACGCCGGGCGCGAG
CCGGTACTGCCCCCGCTGCCCGTGCAGTACGCCGACTACGCGGAGTGGGAGCGCGACTGG
CTGTCCGGCCCGACCCTGCGCCGCCAGCTGGACTACTGGACGAAGCGGCTGGACGGCATG
GCGCCCGCGCTGGAGCTGCCCACCGACCGGCCCAGGCCCTCGGTCGCCCGCCAGGAAGGC
GACGCGGTGCGCTGGGAGTTGCCGGCCGAACTGATCCGGGCGGCCCGCCGACTGGGCGCC
GGGGAGAACGCGACCCTCTATATGACCCTGCTGGCCGCCTTCCAACTGGTGCTGGGCCGG
TACGTGGACAGCGACGACATCACGGTGGGCACCCCCGTGGCCAACCGGGGCCGCGCCGAG
GTCGAGGGCCTCATCGGGTTCTTCGTCAACACCGTGGTGCTGCGGACCGATCTGTCCGGC
GACCCCACCTTCCGCCAACTGCTGGGCCGGGTCCGCGACATGGCGGCCGGTGCATTCGCC
CATGGCGACCTGCCCTTCGAATATCTGGTGGAGCAGGTGCACCCCGAGCGGGACCTGTCG
CGCAACCCGCTGGTCCAGGTGCTCTTCCAGATGATCAACGTACCGGCGGAGCGGCTCGCC
CTGCCCGGCGCGCGGACCGAGCCCTACGACCACGGCGGCATCCTCACTCGAATGGATCTT
GAGGTCCATCTCGTCGAGATCGAGGACGGAGTTCTCGGACACATCGTCTTCAGCAAGGCC
CTGTTCGACACGAGCACCATTGAACGGCTGCTGCACCACGTCACCGTCGTCCTCCGGGGC
GTCCTGGCCGAGCCGGACCGGTGCATCTCCGAGATCTCGCCGCTCGACGAGGCGGAGCGG
ACGAAGGTCCTGGAGGAGTTCAACGCGACCACGGGCCCCGTACCCGCCGGATCCCTGCCC
GCGCTCTTCACCGCCCAGGTCGAGCGCCGCCCCGATGCGGTGGCCGTGATCAGCGGTGGT
GACCGGGTGACCTACGCCGAGCTGGATCAGCGGGCGAACCAGCTCGCCCATCTGCTGGCG
GGACGGGGGGTCGGCCCCGAGGCCCTGGTCGGGCTCTGCGTCGATCGCGGCATCGAGATG
ATCGTGGCGATCCTCGCGATCCTCAAGCTGGGAGCGGCCTATGTGCCGATCGATCCCAAC
CACCCCCGGGGCCGCGTCCAGTTCGTCCTGGCCGACGCCGGGGTGACCGTCGCCGTCACC
CAGCAGCGTTTCACCGGCCTGCTCGAAACGCCGGAGGCACCCGGGAAGCCGGAAGTATCC
GGGACACATGGGGTGCCTGGAGCAGCACCCGGGGCGCCCGACGCGCCCGAGGCATCCGGG
ACGCCCGATGCGCCCGGGACGCCCGGCATTCGGCTGATCCTGCTTGACGCCGAGCGCGAA
CCGCTCGCCGGGCAGCCCCGGACCCCGCCCACGGCACGGCCCAGCGCCCAGAACCTCGCC
TACGTCATTTACACCTCCGGCTCCACCGGAGTCCCCAAGGGCATCCTCATGCCCGCCACC
TGTGTGCTCAACCTGGTGGCCTGGCAGAAGAAGGCCCTGCCGATCGGTCCCGACGCCAAG
ACGGCACAGTTCGCCATGCTGACCTTCGACATCTCGTTGCAGGAGATCTTCTCCGCGCTG
CTGTACGGCGAGACGATCGTCGTCCCCGGCGAGGAACTCCGCATGGACCCCGTCGAGTTC
GCCACATGGGTCCACACCAACGAGATCGACCAGCTCTTCGTCCCGAATGTGATGCTGCGG
GCGATCTCCGAGGAGGTGGATCCGCACGGCACCGAGCTGGCCGCACTGCGCCACCTCTCA
CAGGCCGGCGAACCCCTCTCCCTCCACCACGATCTGCGCGAGCTGTGCGCCCACCGCCCC
GAGCTGCGGCTGCACAACCACTACGGCCCCAGCGAAGCCCATGTGGTGACGTCGTACTCG
CTCCCCGCCGAGGTGGCCGAGTGGCCGCTCACCGCACCCATCGGCCGCCCGATCGGCAAC
ACCCGGGTGTATGTGGTCGACCGACGGCTCCGGCCCGTCCCGGTGGGGGTGCCCGGCGAG
CTGTGCGTGGCCGGAGAGGGCCTGGCCAGGGGCTATCTCGGCCGCCCGGATCTGACCGCC
GCCCGATTCGTGGCCGACCCGTTCCGGGGCGATGGATCGCGTATGTACCGCTCCGGCGAT
CTGGTGCGCTGGCTGCCCGACGGCAACCTGGAATTCCTCGGCCGGATCGACGACCAGGTG
AAGATTCGTGGCTTCCGGATCGAACCGGGCGAGATCGAGGCGATCCTCGCCCGCCACCAG
GACGTTCTGCACACGGCCGTGATGGTGCGCGAGGACACCCCCGCCGACAAGAGGCTGGTG
GCCTATGTGGTGGCCGACGCCACCGCCGCGGACCGGCCCGGCCGGCTGACCGAGACCCTG
CGTCGGTACGTCGAGTCCGCGGTGCCCGAATACATGGTGCCCTCCGCGTTCGTGCTGCTG
GACACCATGCCCGTGACCTCCGGCGGCAAGATCGACCGGAAGGCGCTGCCCGCTCCCGAT
CTGCGCACCGTGCTCGAGGTCGGCTACGTCGCCCCCCGCACCCCCGAGGAAGAGGCCGTC
TGTCGGGTCTACACGGATCTGCTCGGCGCCACCAGGGTCGGCATCGACGACGACTTCTTC
GCACTGGGCGGCCATTCCCTCATCGCCACCAGGGTGGTCGCCAGGCTCAGGTCCGCCCTC
GGTATCGCCGTACCGCTGAAGGCCGTCTTCCAGCAGCGCACCCCCCGACAGCTGGCGGCC
ACGCTCACCGCCGCGGCCCGCTCCGGTCCCGAACCCGAGCTGCCGCCGCTGATTCCCACG
CGGCGCGACCAGCCCATCCCCCTCACCTTCGCACAGCAGCAGACGGACCTCTTCTTCGGC
GATGTCCTGGACGCCGGGCACTGGAACATCCCCATGGCGGTGCGGGTGTCGGGCGAACTG
GACCTCGACTGCCTGCGCCGGGCGATGGACCTGCTGATCGACCGCCACGAGGCCCTGCGT
ACCGCCTTCGTCAGGGAAACCGACAGATACGTCCAGGTGATCCGGCCGAGCGCGCCGGTC
CAGGTGGAGGTGGCCGAGGCGCGGGACGAGGCCGAAGCCTCGGTACTGGCCGGCCAGGAG
GCGGCCCGTCCCTTCGACCTCACCCGCGGCCCGCTGGCGAGACTGCGCGTGCTGCGGCTG
GCCGAGTCCGACCATGTGCTGGTGCTCACCCTGCACCACCTGGTCACCGACGGCTGGTCC
CAGGGAGTGCTGGTCCGCGACCTGTCCATCGTGTACGCGGCACTGCTGCGCGGCACCGAA
CCCGATCTGCCACCCGTACCCGTCCAGTACGCCGATGTCGCGAGCTGGGAGCGGAAGTGG
TTGCACGGTCCGCTGCTGCGACGCCAACTCGACTTCTGGAAGCGGCATTTCGCGGGCATG
GCCCCCGCCGAACTGCCCACCGACCGGCCCCGCGCCGCATCGGCCCGCTACGAGAGCGAC
ATCTTCCGCTGGCGACTGCCGAAGGACGCAGTCGAGACCGCCCGACGGCTGGGCGAATCG
TCCAACGCCACCTTGTACATGACGCTGCTGACCGCCCTGAAGGTGGTCATGTCCGCCCGC
TCGGACAACCAGGACGTCCTCGTCGGTGTGCCCACGGCCAACCGGGGCCGGGACGAACTG
GAGAACACGGTGGGCCTCGTCTCCAAGATGCTCGCACTGCGCACCGAAGTGTCCGGCGCC
ACGGACTTCGGCACGCTGCTGGCCACGGTGCGCGATGCGATGTCCGACGCCCATACACAC
CAGGACGTGCCCTTCGTGTCCGTTCTGAAGCACATCGGCGAACACACCGGTGGCCTCGGC
GGCGGCCCCGCTGGTGAGCACACCGATGACCGCGTCGGCGGCCGGGCCGGGACGCGGCTG
TCGGACGATCCACCGGTGAAGGTGATCTTTCAGATCGTCAACACCCCGCCGCGGCCACTC
CGGCTCACCGGACTGACGGCCGAGCCGTTCCTGATGACCCACCCGCCGGTGACCGTCAAC
GTGGACATGGAGATCGACCTGTACGAGAGCGCGGAGGACGGCGGCCTCGCCGGCACCGTG
CTGTACAGCAAGTCCCTCTTCGACCGTGCCACGATCGAGCGGTTCTGTGACGACGTGGTG
GCGGTCGTCTCCACGGCCGCCGCGGATCCCGGACGGCCGGTCTCACAGGTGTGGCAGGGC
CGAGGTCGCGACCAGTGA
[15] C40..338
[15] A524..967
[15] PCP1056..1123
[16] C1144..1437
[15] C118..1014
[15] A1570..2901
[15] PCP3166..3369
[16] C3430..4311

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [524-967]  2.20000000000002e-112 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [40-338]  7.99999999999993e-74 PF00668 [1144-1437]  4.59999999999996e-65 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1081-1096]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1060-1121]  9.5e-12 PF00550
PF00550   PP-binding
 [1049-1160]  1.10000150671642e-21 SSF47336
SSF47336   ACP_like
 [1047-1126]  1.2e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1056-1123]  PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [524-967]  8.49999999999995e-128 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [682-693]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
first first   Merid_00020 Merid_00020