close all open/close all

CDS information : Merid_00020


close this sectionLocation

Organism
StrainDSM 4137
Entry nameMeridamycin
Contig
Start / Stop / Direction12,607 / 29,772 / + [in whole cluster]
12,607 / 29,772 / + [in contig]
Location12607..29772 [in whole cluster]
12607..29772 [in contig]
TypeCDS
Length17,166 bp (5,721 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MerA
Gene
Gene (GenBank)merA
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[17159202] Organization of the biosynthetic gene cluster in Streptomyces sp. DSM 4137 for the novel neuroprotectant polyketide meridamycin. (Microbiology. , 2006)
Related Reference
ACC
Q1WEK9
PmId
[16806745] Isolation and characterization of meridamycin biosynthetic gene cluster from Streptomyces sp. NRRL 30748. (Gene. , 2006)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
2 methylmalonyl-CoA
3 malonyl-CoA
KSQ24..412
AT577..897
ACP974..1044
KS1067..1440
AT1594..1903
KR2158..2334
ACP2432..2502
KS2530..2901
AT3047..3354
DH3396..3554
KR3827..4004
ACP4107..4177
KS4198..4574
AT4723..4991
KR5304..5480
ACP5568..5638

close this sectionSequence

selected fasta
>polyketide synthase [MerA]
MNHPDPENGPADDPAPRKRMEPDEAIAVVGMSCRFPQAPDPEAFWRLLNEGISAISEVPA
GRWIDDRPAPPGTDAPSTPPGTDDPSTSLAADASSTPPAVRHGGFIDDVDRFDPAFFGIS
PREAVAMDPQQRLILELAWEGLEDAGIVPATLRGATVGAFIGAGSDDYGSLIRARGRSHH
TLTGTQRGMLANRLSHVFGLSGPSLTVDAAQASSLVAVHMAVESLRRGESRLALAGGVNL
NLSAETAADIAAFGALSPDGRCFTFDARANGYVRGEGGGLVVLKPLSDALADGDTVYCVI
EGSAVNNDGGGVSLTAPDPDGQRQVLRLAQRRAGISPAAVQYVELHGTGTALGDPAEAEA
LGAVFGRSGGGPVQLGSVKTNIGHLEAAAGIAGLLKTALAIHHRQLPAGLNYRTPNPRIP
MGELNLEMRLAPGEWPKPDNRLVAGVSSFGMGGTNCHVVLAEPPAWASSHASAHHPEPEA
VPAPTLAPIPLPLPLSGVSAAALRGQAMRLRPYLERSPNLTDLAFSLATTRTSFDHRAVL
ISGQATDAAHGLDALAEGGAAAGLVMGTARAAGKLAFAFAGQGSQRLGMGGELSAAFPVF
AQALDEVCTALDAHLDRPLRDVIHGDDAELLDRTVYAQAGLFAVEVALFRLLEDFGLVPD
LLIGHSLGEVSAAHVAGVLSLADAAAFVAARGRLMQAVTEPGAMVSLEATEDEVTRTLMA
GGASDDGVRVCVAAVNGPTATVISGDERAVLDLAAEWTRRGRRTKRLRTSHAFHSPHLDP
VLDELRHIAESLTYQAPRIPLVSNVTGRRATAEELCSPEYWVRHVRRTVRFLDGVRCLEG
EGVTTIVELGPDKALSTLARDCLTGPGTLVGTLRRDRPEPQALVTALAELYASGVEVAWD
PLVSGGRRIPLPTYAFQRQRYWFSAPGAEGGDTSAHGVTSGPERTDTGLSPDEALDEGPS
NSKVLDTGLSGGEVLGMVRAHAAVVLGYETANAIGAEHTFKQLGFDSITAVELCERLGEA
TALPLPGTLLFDYPTPTALAEHLHRRLHGRTDEQAVPATVPTPAGGDPVVIVGMGCRFPG
RAHSPEDLWRIVVDGEDAISGFPSDRGWDLDGLYHPDPDRSGTSYARDGGFLYDAAEFDA
GFFGISPREAAAMDPQQRLLLETSWEALERAGIPAEHIKGSSTGVFIGASSVGYAADAGE
EAEGYQLTGTAASVASGRVSYTLGLEGPAVTVDTACSSSLVALHLAVQSLRAGECSLALA
GGVTVMATPAMFVEFSRQRGLATDGRCKAFAAAADGTGWAEGVGVLVVERLSDAERNGHR
VLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALVSAGLVASDVDAVEAHGYGTTLGDP
IEAQALLATYGQDRDADRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGVLPQTLHVD
EWSPHVDWSGGRVELLTEATPWPMTVRRAGVSSFGVSGTNAHIILEQAPETAQPTRPIPE
GDTEVAAVAWVLSGQGEAGLRAQAERLRAFTAASPCPTPAEVGWSLASTRTTLSHRAVVV
GAGRDELLRGVDAVANGMAAPGVVRGTGAPGDVVFVFPGQGSQWVGMALELVESSSVFAG
RLGECAEALGPLVEWSLWDVLGDEVALSRVDVVQPVLWAVMVSLAELWRSFGVVPSAVVG
HSQGEIAAACVAGGLSLEDGARVVALRSRALLALSGRGGMVSVPVSADRLRDRAGLSVAA
VNGPVSTVVSGPVEALDAVLEEFPEAKRIPVDYASHSVQVEEIREGLAEALASVRPRTGE
VPFYSTVTGRLMDTSELDAEYWYRNLRETVEFQSTVEHLMREGHTVFVEASPHPVLTVGI
QDTADATDTTHTDILVTGSLRRDDGTVQRFLTSLAELHVRGVRIDWGPLFAGVSPVELPT
YAFQRERFWLGADTAESAVDTWRYQISWNRLPDLDTPDLSGTWLAVVPEGDDEWTMAGAR
ALAEPGRASVRTLQVPCDTDRRTLTGLLMDVAGSDDIAGVVSFLAADERAHPTHPALSRG
MAHTVELLCALTTADVEAPLWCVTRAAVMALPTDPAPSPAQAAVWGFGRVAGLERSERWG
GLIDLPVHCDAQVLRRFVAVLAQATGEDQVAVRPLAVLGRRLEPAPRTGPADAWRPHGTV
LITGGTGALGAHVARWLAQSGAEHLVLLGRRGQKAPGAAALEDELTALGVRVTMTACDVT
DRAALAGVLASVPELTAVVHLAGTVRFGGSLDADLDEYAAVFDAKVTGALHLDELLDHAS
LEAFVLFSSAAAVWGGVGQAGYAAANALLDAVAQRRRARGLPTTSIGWGTWGGSLAPEDE
QRLSRIGLRPMRPEVAVTALRHVVGSAEPCPAIADIDWETFGPAFTAGRPSPLLSALPRL
RNSSDTMAMAGERSGLRRRLAEVSTADQDRTLVDLVREHAAELLGHHGPAAIDPTVPFRR
LGFDSLTAVELRTRLNAATGLRLPATLLFDHPSCRAVADLLRSELLGGRSGPLAVPSATE
AAPVGAVASDEPIAIVAMSCRFPGGIESPEDLWRVVSEGREVLSDFPDDRGWDVEALYDP
DPDRPRTSYVRTGAFLHDAAEFDPELFGISPREALAMDPQQRLLLESAWQVLERARMAST
SMRSSRTGVFIGGWGQGYPSASDEGYALTGAATSVMSGRIAYALGLEGPALTVDTACSSS
LVALHLASEALRRGECSLALAGGVTVMATPSTFVEFSRQRGLAPDGRCKAFAGAADGTGW
GEGVGMLLLERLSDAERNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAR
LSTVDVDVVEAHGTGTTLGDPIEAQALLATYGQDRDADRPLWLGSLKSNIGHTQAAAGVA
GVIKMVMAMRHGVLPRTLHVDEPTPKVDWTTGAVELLTEPAEWPQEGRPRRAGVSAFGVS
GTNAHVILEQAPEVAAERRQGRDEPVAVPWVLSGANEAALRGQIERLRAFVDDNPTLDPV
DVGWSLTSTRALLPYRTVVVGADLAELRHGLDTAEVVGAAEPDRGAVLVFPGQGSQWVGM
ALELVESSSVFAGRLGECAAALGPLVEWSLWDVLGDEVALSRVDVVQPVLWAVMVSLAEL
WRSFGVVPSAVVGHSQGEIAAACVAGALSLEDGARVVALRSRALLALSGRGGMVSVPVSA
DRLRGRAGLSVAAVNGPVSTVVSGPVEALDAVLEEFPEAKRIPVDYASHSVQVEEIREGL
AEALASVRPRTGEVPFYSTVTGRLMDTVELDGEYWYRNLRETVEFRSAVEGLLELGHTVF
VEASPHPVLTVGIQDTADATDTDILVTGSLRRDDGGLTSFLTALARLHVRGVAVEWRDAF
TGLDAHAVELPTYAFQRRRFWAASLQRTPGAGELDHPLLGALVPLPESGGGLLTGVLTLA
GQPWLAEHSVSGVVLFPGAGFVELVLQAGLWLGCEVVEELTLEGPLVFSERGGVEVQVVV
GGVGEGGCRSVSVFSCRGGEWVRHAVGVLGVGAGVVSGVEVVWPPVGAVRVGVEGVYEGL
AERGYVYGPVFQGLRDAWRRGDEVFVEAVLPADARGDAARCAIHPALLDAALHGIGLGAL
ITDDGRAYLPFSWSGVRLHAVGASAVRMALTPAGPDTVSLRVTDEAGQPVLSVDSLVLRP
VADGQLAEAEVGNRDALYRVEWVDVGVCSVGSLVEWGEVSTGGVVRECVVLSGVDVVGVL
EVLRAWVLEERFAGSRLVVVTRGAVSVGGEGVEDVGGGAVWGLVRSAQSEHPGRFVLVDV
EEGVEGDVVPDVVGLGESQVAVRGGRVWVPRLVGVNATDVRRGLGSGVALVTGGTGLLGG
LVARHLVSVYGVGELVLVSRRGWDAAGAEALVDELQGLGARVRVVACDVADRGAVAELVG
SIEGLGVVVHAAGVVDDGVIGSLDGGRLRGVMEPKALGAWHLHELTRELDLSAFVLFSSA
ASVLGNAGQGGYAAANGFLDVLAAHRRALGLPAVSIAWGFWEERSELTADLAEVQLSRIS
RSVGTSISSAQGLDLFDAALAADEPMVLATPLNLPALREQAAAGTLPSILSGLVTAPVRR
AVDSGRTPAGLRHQLAGVTEAERQNRILRLVREHVAGVLGHASAESVDASRTFQEIGFDS
LTAVELRNRISAAIGVRLPATAVFDHPTPRLLAERVLAEVWGSLPTAAPIMPVSAVDDEP
IVIVGMSCRFPGGVGSPEDLWHLVNSATDAVSALPTDRGWDLATLSGGKGGAGASYAQDG
GFLYDAAEFDAGFFGISPREATAMDPQQRLLLETAWEVFERAGIAPDTLKGSRTGVFTGV
MYHDYGSWLTDVPDDVEGYLGTGIAGSVASGRLAYTFGLEGPALTVDTACSSSLVALHLA
AESLRRGECSLALAGGVTVLATPQVFVEFTRQGGLAPDGRCKSFAAGADGTGWSEGVGLL
LVERLSDAERNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIQQALASAGLAARDVD
AVEAHGTGTTLGDPIEAQALLATYGQDRDPGRPLWLGSVKSNIGHTQAAAGVAGVIKMVM
AMRHGVLPRTLHVDEPSPHVDWSAGAVELLGEHTAWPEAGRPRRAGVSSFGASGTNAHVI
LEQAPDTASEPEPGPARSELPAIPWVFSAQDEAGVRAQAVRLRAFADRNADLDPVDVGWS
LAATRAGLSHRAVVVGADREELLGALEGAPVVGVPVVGGLGVLFAGQGSQRLGMGRGLYE
AYPVFAVAWDEVCAELDRYVDRSVGEVVWGDDAELIGETVYAQAGLFALEVALYRLIASW
GVKPDYLLGHSIGELAAAYVAGVWSLEDAARVVAARGRLMQGLPSGGVMVAVAASEGEVL
PLLADAVSVAAVNAPESVVVSGDEDAVRAVADVLRGVRTRRVRVSHAFHSARMDGMLAEF
GEVLLAGVEFHAPSLPVVSNVTGEVAGEELCSPEYWVRHVRETVRFADGLDTLRELGVGS
FLELGPDGTLAALTDGDGLPVLRRDRPEPLSLMAALGGLYVRGVGVDWGAVFPGGRRVDL
PTYAFQRQRFWLEPSSAEPTTSATDAAFWAAVERGDLGSFGIDAEQPLSAALPALASWRR
TRQEQSVIDGWRYRLSWTPIPAVSGESGLTGTWLLVVEPGGGADDLVGAMRAAGAEVRTV
TVAEVAEAARLGAPETVSATAGVVSMLPVEETVAVLQTLRTTAPLWCVTRGAVSVVDGDV
VDPVQSGVWGLGRVIGLEYPDRWGGLVDLPGVVDEEAGVWLCRVLGGGTGEDQVAVRGGG
AWGARLVRVVGSGLGGSVVWRGGGSALVTGGTGALGGHVARWLAGAGVENIVLVSRRGLA
APGVLRLVAELEGLGSGVRVVGCDVGVRDQVVGLLEGIADLRVVVHAAGVLDDGVLESLS
AGRVGEVWRVKVEGALYLDELTRGRGLDAFVLFSSAAGTVGSAGQGSYAAANAALDGLAW
RRRAQGLVATSVAWGAWADSGMGAAQRQLPGMPPELAVAALQQSLVEDETALMIADVEWS
SFGSRFTAVRPSPLLSELLPLATTPMEPVEELATRLRDMSRLERDRAVLELVRAQVAAVL
GHAKPASVDPSRTFQEVGFDSLTAVELRNRLATATGVPFPASVIFDYPTPAALADHVRTR
FVPDEGEDGAGGGTTSVLAELTRLEAALSDLSPTDMAGAEVAAKIKSLLSHWGAATNSDI
EVDSATDEEMFDLLGKEFGIS
selected fasta
>polyketide synthase [MerA]
GTGAACCATCCCGACCCCGAGAACGGTCCCGCAGACGATCCCGCCCCGAGGAAACGCATG
GAACCGGACGAGGCCATCGCCGTTGTCGGAATGTCCTGCCGCTTTCCGCAGGCACCCGAC
CCCGAGGCGTTCTGGCGGCTGCTGAACGAGGGCATCTCGGCCATCAGCGAGGTGCCCGCG
GGCCGCTGGATCGACGACCGGCCCGCGCCGCCCGGGACCGATGCCCCGTCCACGCCGCCC
GGGACCGACGACCCGTCCACGTCGCTTGCGGCCGACGCCTCGTCCACGCCGCCCGCCGTC
CGTCACGGCGGCTTCATTGACGACGTCGACCGCTTCGACCCGGCGTTCTTCGGCATCTCA
CCACGGGAAGCCGTGGCGATGGACCCCCAGCAGCGGCTGATACTCGAGCTGGCCTGGGAA
GGACTGGAGGACGCGGGCATCGTGCCCGCCACCCTGCGGGGCGCCACGGTCGGAGCGTTC
ATCGGCGCCGGGTCCGACGACTACGGCTCGCTGATCCGCGCCCGCGGCCGTTCACACCAC
ACGCTGACCGGCACCCAGCGGGGCATGCTCGCGAACCGGCTCTCCCATGTGTTCGGCCTG
AGCGGCCCGAGCCTGACCGTGGACGCGGCCCAGGCGTCCTCCCTGGTCGCGGTGCACATG
GCCGTGGAGAGCCTGCGCCGCGGCGAGTCACGGCTCGCGCTGGCGGGCGGGGTCAACCTG
AACCTCTCGGCGGAGACCGCCGCCGATATCGCCGCGTTCGGCGCGCTCTCCCCGGACGGC
CGCTGCTTCACCTTCGACGCACGCGCCAATGGCTATGTGCGGGGTGAGGGCGGCGGACTG
GTCGTCCTGAAGCCGCTCTCCGACGCACTTGCCGACGGCGACACCGTCTACTGCGTGATC
GAGGGCAGCGCGGTCAACAACGACGGCGGCGGTGTATCGCTCACCGCACCCGACCCGGAC
GGCCAGCGACAGGTGCTCCGGCTCGCCCAGCGGCGGGCCGGGATCTCCCCCGCTGCCGTT
CAGTACGTGGAACTGCACGGCACCGGAACGGCACTCGGCGACCCGGCGGAAGCGGAGGCC
CTGGGCGCGGTCTTCGGCCGGAGCGGAGGGGGGCCGGTGCAGCTGGGGTCGGTGAAGACC
AACATCGGCCACCTCGAAGCCGCCGCCGGTATCGCCGGACTTCTGAAGACCGCGCTGGCC
ATCCACCACCGGCAGCTGCCGGCCGGTCTCAATTACCGTACGCCGAATCCCCGTATCCCC
ATGGGCGAGCTCAACCTGGAGATGCGCCTGGCCCCGGGGGAGTGGCCGAAGCCGGACAAC
CGCCTGGTCGCCGGTGTCAGCTCGTTCGGGATGGGTGGCACCAACTGCCACGTCGTACTC
GCCGAACCACCCGCCTGGGCCTCCTCCCACGCCTCCGCACACCACCCTGAGCCTGAGGCC
GTACCGGCCCCGACCCTCGCCCCGATCCCGCTTCCGCTTCCGCTGTCCGGGGTGTCCGCT
GCCGCGCTCCGCGGCCAGGCGATGCGGCTACGGCCGTATCTGGAGCGATCGCCGAACCTC
ACCGACCTCGCCTTCTCCCTCGCCACCACACGAACCTCCTTCGACCACCGCGCGGTGTTG
ATCAGCGGGCAGGCGACTGACGCGGCACACGGCCTGGACGCGCTCGCCGAAGGCGGCGCG
GCGGCGGGTCTGGTGATGGGCACGGCGCGGGCGGCGGGAAAGCTCGCCTTCGCCTTCGCG
GGCCAGGGCTCACAGCGTCTCGGCATGGGAGGTGAACTCAGTGCCGCCTTCCCCGTGTTC
GCCCAAGCCCTCGACGAGGTGTGCACGGCGCTGGACGCACACTTGGACCGGCCCCTTCGG
GACGTGATCCACGGTGACGACGCCGAACTGCTCGACCGGACGGTGTACGCCCAGGCCGGA
CTGTTCGCGGTGGAGGTGGCGCTGTTCCGGCTGCTGGAGGACTTCGGCCTCGTACCGGAC
CTGCTGATCGGCCACTCCCTCGGCGAGGTGAGCGCCGCCCATGTCGCCGGTGTGCTGTCG
TTGGCGGACGCCGCCGCCTTCGTCGCCGCCCGTGGGCGGCTGATGCAGGCCGTGACGGAG
CCGGGCGCCATGGTGTCGCTCGAAGCCACCGAGGACGAGGTCACCCGGACGCTCATGGCG
GGCGGGGCATCGGACGACGGTGTCCGGGTCTGCGTGGCGGCGGTCAACGGCCCCACCGCC
ACGGTGATCTCGGGGGATGAGCGCGCCGTACTCGACCTGGCGGCGGAGTGGACCCGCCGC
GGGCGTCGGACGAAGCGGCTCCGGACGAGCCACGCCTTCCATTCGCCCCATCTGGACCCC
GTACTGGACGAGCTTCGGCACATCGCCGAGAGCCTCACGTACCAGGCGCCCCGGATCCCG
CTGGTGTCGAATGTGACCGGCCGACGTGCCACGGCGGAAGAGCTGTGTTCCCCGGAGTAC
TGGGTACGGCATGTCCGCCGGACCGTACGGTTCCTGGACGGCGTCCGCTGTCTGGAGGGC
GAAGGCGTCACCACCATCGTGGAACTGGGCCCGGACAAGGCACTCAGCACCCTGGCCCGC
GACTGCCTGACCGGGCCCGGGACGCTGGTGGGCACACTCCGTCGCGACCGGCCCGAGCCA
CAGGCCCTGGTCACCGCGCTGGCCGAGCTGTATGCCTCGGGTGTCGAGGTGGCATGGGAC
CCGCTGGTGTCCGGTGGGCGGCGGATTCCACTGCCCACGTATGCCTTCCAGCGGCAGCGG
TACTGGTTCTCCGCTCCCGGGGCCGAGGGCGGGGACACGTCTGCCCATGGGGTCACATCG
GGGCCCGAGCGCACGGACACCGGCCTGAGCCCCGATGAGGCGCTCGACGAGGGCCCGAGC
AACAGCAAGGTGCTCGACACCGGCCTGAGTGGCGGCGAGGTGCTCGGCATGGTCCGGGCG
CACGCGGCCGTCGTGCTCGGATACGAAACGGCGAACGCCATCGGAGCCGAGCACACCTTC
AAACAACTCGGGTTCGACTCGATCACCGCCGTCGAACTGTGTGAACGGCTCGGTGAGGCG
ACCGCCCTCCCGCTGCCCGGCACCTTGCTGTTCGACTATCCGACGCCCACCGCGCTCGCC
GAGCATCTGCACCGCAGGCTCCACGGCCGGACGGATGAGCAGGCCGTGCCCGCGACCGTG
CCGACACCCGCCGGCGGCGACCCGGTGGTGATCGTGGGGATGGGCTGCCGGTTCCCCGGC
CGGGCGCATTCGCCGGAGGACCTCTGGCGGATCGTGGTCGACGGCGAGGACGCCATCTCC
GGCTTTCCGTCCGACCGGGGCTGGGACCTCGATGGCCTCTACCACCCCGACCCCGACCGC
TCCGGCACGTCATACGCGCGCGACGGCGGATTCCTGTACGACGCGGCCGAGTTCGACGCG
GGGTTCTTCGGGATCTCGCCGCGGGAAGCCGCGGCGATGGACCCGCAGCAGCGGCTGCTG
TTGGAGACGTCGTGGGAGGCGTTGGAACGGGCGGGGATCCCCGCGGAGCACATCAAGGGC
AGTAGCACGGGCGTGTTCATCGGCGCCTCGTCGGTCGGCTACGCGGCGGACGCCGGAGAG
GAGGCCGAGGGCTATCAGCTGACCGGCACCGCCGCGAGCGTGGCCTCGGGCCGGGTGTCC
TACACCCTGGGCCTCGAAGGCCCGGCGGTCACCGTGGACACGGCCTGCTCGTCCTCGCTG
GTGGCATTGCACCTGGCCGTGCAGTCGCTGAGGGCGGGCGAGTGCTCGTTGGCATTGGCG
GGCGGCGTGACCGTGATGGCCACACCGGCGATGTTCGTGGAGTTCTCCCGCCAGCGGGGG
CTGGCCACGGACGGTCGGTGCAAGGCGTTCGCGGCGGCGGCGGACGGCACGGGGTGGGCC
GAAGGCGTCGGGGTCCTTGTGGTGGAGCGGTTGTCGGATGCTGAGCGGAATGGGCATCGG
GTGTTGGCGGTGGTGCGGGGTAGTGCGGTGAATCAGGATGGTGCGTCGAATGGTTTGACT
GCGCCGAATGGTCCGTCGCAGCAGCGTGTCATCCGGCAGGCGCTGGTGAGTGCGGGTCTT
GTGGCGTCGGATGTGGATGCGGTGGAGGCGCACGGGTACGGTACCACGTTGGGTGATCCG
ATCGAGGCGCAGGCGTTGTTGGCCACCTATGGTCAGGACCGGGATGCGGATCGGCCGCTG
TGGCTGGGCTCCGTGAAGTCGAACATCGGTCATACGCAGGCCGCGGCGGGCGTGGCCGGT
GTGATCAAGATGGTGATGGCGATGCGGCATGGGGTGCTGCCGCAGACGCTGCACGTGGAT
GAGTGGTCGCCCCACGTCGACTGGTCCGGCGGCCGGGTGGAGCTGCTCACCGAGGCAACG
CCATGGCCCATGACCGTTCGCCGAGCGGGCGTCTCATCGTTCGGAGTAAGCGGCACCAAC
GCTCACATCATCCTGGAACAGGCCCCGGAGACGGCCCAGCCGACCAGGCCCATCCCGGAA
GGCGACACCGAAGTGGCGGCCGTTGCCTGGGTGTTGTCGGGACAGGGCGAGGCTGGGCTG
CGGGCCCAGGCCGAGCGGCTGCGCGCCTTCACGGCGGCCAGTCCCTGTCCCACCCCGGCG
GAGGTGGGATGGTCACTGGCATCGACACGTACGACGTTGTCGCACCGAGCGGTGGTCGTG
GGCGCTGGACGCGACGAGTTGCTACGTGGTGTGGACGCTGTGGCGAACGGGATGGCCGCT
CCGGGAGTGGTACGGGGCACCGGAGCCCCCGGGGACGTGGTGTTTGTCTTCCCTGGTCAG
GGGTCGCAGTGGGTGGGGATGGCGTTGGAGTTGGTGGAGTCGTCTTCGGTGTTTGCGGGG
CGGTTGGGTGAATGTGCGGAGGCGTTGGGCCCGTTGGTGGAGTGGTCGTTGTGGGATGTG
TTGGGTGATGAGGTGGCGCTCAGTCGGGTTGATGTGGTGCAGCCGGTGTTGTGGGCGGTG
ATGGTGTCGTTGGCGGAGTTGTGGCGTTCGTTTGGTGTGGTGCCGTCGGCGGTGGTGGGT
CATTCGCAGGGTGAGATTGCGGCGGCGTGTGTGGCCGGTGGGTTGTCCCTGGAGGATGGT
GCCCGGGTGGTGGCCTTGCGGAGCAGGGCATTGCTGGCCCTGTCGGGTCGGGGTGGGATG
GTGTCGGTTCCGGTGTCTGCCGACCGGTTGCGGGATCGTGCTGGACTGTCGGTGGCGGCG
GTGAATGGTCCGGTGTCGACGGTGGTATCCGGGCCGGTTGAGGCGCTGGATGCGGTGTTG
GAGGAGTTCCCGGAGGCCAAACGGATCCCTGTGGATTACGCCTCGCATTCGGTGCAGGTG
GAGGAGATCCGGGAGGGGCTGGCGGAGGCGTTGGCGTCGGTCCGTCCGCGTACGGGTGAG
GTGCCCTTCTACTCGACGGTGACCGGCCGGCTGATGGACACCAGCGAGCTGGACGCGGAG
TACTGGTATCGGAATCTGCGTGAGACGGTGGAGTTCCAGAGCACCGTCGAACACCTTATG
CGCGAGGGGCATACGGTGTTTGTCGAGGCCAGTCCGCATCCGGTGCTGACCGTCGGCATC
CAGGACACTGCCGACGCCACCGACACCACCCACACCGACATCCTCGTCACCGGGTCCCTG
CGTCGTGACGATGGCACTGTTCAGCGGTTTCTGACCTCCCTGGCCGAGCTCCACGTGCGC
GGTGTCCGGATCGACTGGGGCCCGCTCTTCGCCGGTGTCTCGCCCGTCGAGCTGCCAACG
TATGCCTTCCAACGGGAACGGTTCTGGCTTGGGGCGGACACCGCCGAGTCCGCCGTGGAC
ACGTGGCGATACCAGATCTCCTGGAATCGGCTGCCGGACCTGGACACCCCGGACCTCTCC
GGGACATGGCTGGCTGTGGTCCCCGAAGGGGACGATGAGTGGACCATGGCGGGGGCACGG
GCGCTGGCCGAGCCGGGCAGGGCCAGCGTCCGTACCCTCCAGGTGCCCTGCGACACGGAC
CGCCGGACCCTGACCGGGCTGCTGATGGATGTGGCGGGATCCGACGACATCGCCGGTGTC
GTCTCGTTCCTGGCCGCCGACGAGCGTGCGCATCCGACCCACCCCGCGCTGTCCCGGGGG
ATGGCGCACACGGTCGAGCTGTTGTGCGCGCTCACCACCGCTGATGTCGAGGCCCCGTTG
TGGTGTGTGACCCGAGCGGCTGTCATGGCACTTCCGACGGACCCGGCGCCGAGCCCCGCC
CAGGCAGCCGTATGGGGGTTCGGGCGGGTGGCCGGGCTGGAACGATCCGAGCGCTGGGGC
GGCCTGATCGACCTGCCCGTCCACTGCGACGCACAGGTGTTGCGGCGGTTCGTCGCCGTA
CTCGCGCAGGCAACCGGTGAGGACCAGGTGGCGGTACGGCCATTGGCGGTCCTGGGCCGA
CGGTTGGAACCGGCGCCCAGGACCGGACCGGCCGACGCATGGCGCCCACACGGCACGGTG
CTGATCACCGGTGGCACCGGCGCGCTGGGCGCACATGTGGCACGGTGGCTGGCGCAGTCC
GGCGCGGAACACCTGGTGCTGCTCGGCCGCCGTGGCCAGAAGGCTCCGGGGGCCGCCGCG
CTCGAGGACGAACTGACCGCGCTCGGCGTACGAGTGACCATGACGGCCTGCGATGTGACC
GACCGGGCCGCTCTCGCCGGGGTGCTGGCGTCGGTGCCGGAACTCACCGCCGTGGTGCAT
CTCGCGGGGACCGTGCGATTCGGCGGTTCCCTCGACGCGGACCTCGACGAGTACGCCGCC
GTCTTCGACGCCAAGGTCACCGGTGCCCTGCACCTGGACGAGCTTCTCGACCACGCGTCA
CTGGAGGCGTTCGTCCTCTTCTCCTCGGCAGCGGCCGTCTGGGGCGGCGTCGGCCAGGCC
GGTTACGCGGCGGCGAACGCCCTGCTCGACGCGGTGGCACAGCGGCGTCGGGCACGCGGT
CTGCCGACCACCTCGATCGGATGGGGCACCTGGGGCGGCAGCCTCGCGCCCGAGGACGAG
CAGCGGCTGAGCCGTATCGGCCTGCGCCCGATGCGGCCGGAGGTGGCCGTGACCGCGCTG
CGCCACGTCGTCGGGTCGGCCGAGCCCTGCCCGGCCATCGCGGACATCGACTGGGAGACC
TTCGGCCCGGCCTTCACGGCCGGTCGGCCCAGCCCCCTGCTCAGCGCACTGCCGCGGCTG
CGAAACAGCTCCGACACCATGGCCATGGCCGGTGAACGCTCCGGGCTGCGGAGGCGACTG
GCCGAGGTGTCCACGGCCGACCAGGACCGGACACTGGTGGATCTGGTACGTGAGCATGCG
GCCGAGCTTCTGGGACACCACGGCCCGGCGGCGATCGACCCCACGGTGCCATTCCGGCGA
CTGGGCTTCGACTCGCTGACGGCGGTCGAGCTGCGGACCCGGCTGAACGCGGCTACCGGA
CTGCGTCTCCCGGCCACCTTGCTGTTCGACCACCCGAGCTGCCGGGCGGTCGCCGACTTG
CTGCGCTCGGAACTGCTCGGCGGCCGCTCGGGCCCCCTCGCGGTGCCGTCTGCCACGGAG
GCCGCGCCCGTCGGCGCGGTGGCCTCCGATGAGCCGATCGCCATCGTTGCGATGAGCTGC
CGCTTCCCGGGAGGCATCGAATCCCCCGAGGACTTGTGGCGGGTGGTCAGCGAGGGCCGG
GAAGTGCTCTCCGACTTCCCCGACGACCGTGGCTGGGACGTGGAAGCGCTGTACGACCCG
GATCCGGACCGGCCCCGCACCAGCTATGTGCGTACTGGCGCATTCCTCCACGACGCCGCG
GAGTTCGACCCGGAACTCTTCGGAATATCCCCGCGTGAGGCGCTGGCGATGGACCCTCAG
CAGCGGCTGCTGCTGGAGTCGGCGTGGCAGGTGTTGGAGCGCGCCAGGATGGCGTCGACA
TCCATGCGGTCCAGCAGGACCGGCGTCTTCATCGGCGGCTGGGGCCAGGGCTATCCCTCG
GCATCGGACGAGGGGTATGCCCTGACCGGCGCCGCGACCAGCGTGATGTCCGGTCGTATC
GCCTACGCGCTGGGGCTGGAGGGCCCCGCCCTGACCGTGGACACGGCATGTTCGTCCTCG
CTGGTGGCGCTGCATCTGGCGAGCGAGGCGCTACGGCGGGGCGAGTGCTCGTTGGCGCTC
GCGGGCGGCGTGACGGTGATGGCGACGCCCAGCACCTTCGTGGAGTTCTCGCGCCAGCGC
GGGCTGGCCCCGGACGGGCGCTGCAAGGCGTTCGCCGGAGCGGCGGACGGCACGGGGTGG
GGCGAGGGCGTGGGCATGCTGCTGTTGGAGCGGTTGTCCGATGCTGAGCGGAACGGCCAT
CGGGTGTTGGCGGTGGTGCGGGGTAGTGCGGTGAATCAGGATGGTGCGTCGAATGGTTTG
ACGGCACCGAACGGTCCGTCGCAGCAGCGGGTGATTCGCCAGGCGCTGGCGAACGCACGG
TTGTCCACGGTCGACGTGGATGTGGTGGAGGCGCACGGTACGGGTACGACGCTGGGTGAT
CCGATCGAGGCGCAGGCGTTGTTGGCCACCTATGGTCAGGACCGGGATGCGGATCGGCCG
CTGTGGTTGGGGTCCTTGAAGTCGAATATTGGTCATACGCAGGCTGCGGCGGGTGTGGCC
GGTGTGATCAAGATGGTGATGGCCATGCGGCACGGGGTGCTGCCGCGAACGCTGCATGTG
GATGAGCCGACACCGAAGGTGGATTGGACCACCGGCGCGGTGGAATTGCTCACCGAGCCG
GCCGAGTGGCCGCAGGAGGGCCGGCCGCGTCGAGCCGGGGTGTCGGCTTTCGGGGTGAGC
GGCACCAACGCCCATGTGATTCTGGAGCAGGCACCGGAGGTGGCGGCCGAGCGACGGCAG
GGGCGTGACGAGCCGGTGGCGGTGCCGTGGGTGCTGTCGGGCGCGAACGAGGCGGCTCTG
CGCGGCCAGATCGAACGGTTGCGGGCCTTTGTCGACGACAACCCCACCCTTGATCCAGTG
GACGTGGGCTGGTCGCTGACGTCCACGCGTGCGCTTCTGCCGTATCGCACCGTCGTCGTG
GGCGCGGACCTCGCCGAGCTGCGTCATGGGCTGGACACGGCGGAGGTCGTGGGCGCGGCC
GAGCCGGACCGTGGTGCGGTTTTGGTGTTCCCTGGTCAGGGGTCGCAGTGGGTGGGGATG
GCGTTGGAGTTGGTGGAGTCGTCTTCGGTGTTTGCGGGGCGGTTGGGTGAGTGTGCGGCG
GCGTTGGGCCCGTTGGTGGAGTGGTCGTTGTGGGATGTGTTGGGTGATGAGGTGGCGCTC
AGTCGGGTTGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCGTTGGCGGAGTTG
TGGCGTTCGTTTGGTGTGGTGCCGTCGGCGGTGGTGGGTCATTCGCAGGGTGAGATTGCG
GCGGCGTGTGTGGCGGGTGCGTTGTCCCTGGAGGATGGTGCCCGGGTGGTGGCGTTGCGG
AGCAGGGCATTGCTGGCTCTGTCGGGTCGGGGTGGGATGGTGTCGGTTCCGGTGTCTGCC
GATCGGCTTCGTGGCCGTGCGGGGTTGTCGGTGGCGGCGGTGAATGGTCCGGTGTCGACG
GTGGTGTCGGGGCCGGTTGAGGCGCTGGATGCGGTGCTGGAGGAGTTCCCGGAGGCCAAG
CGGATCCCTGTGGACTACGCCTCGCATTCGGTGCAGGTGGAGGAGATCCGGGAGGGGCTG
GCGGAGGCGTTGGCGTCGGTCCGGCCGCGTACGGGTGAGGTGCCGTTTTATTCGACGGTG
ACGGGGCGGTTGATGGATACCGTCGAGTTGGATGGGGAGTACTGGTATCGGAATTTGCGT
GAGACGGTGGAGTTCCGGTCCGCGGTCGAGGGGCTGCTGGAGCTTGGTCATACGGTGTTT
GTCGAGGCCAGTCCGCATCCGGTGCTGACCGTCGGCATCCAGGACACCGCCGACGCCACC
GACACCGACATCCTCGTCACCGGGTCACTGCGCCGCGACGACGGCGGTCTTACCTCCTTC
CTCACCGCGCTGGCCCGGCTGCATGTCCGGGGTGTCGCGGTGGAGTGGCGGGATGCGTTC
ACCGGACTGGATGCGCACGCCGTGGAACTGCCGACCTACGCCTTTCAGCGTCGGCGCTTC
TGGGCGGCTTCTCTCCAGCGGACACCCGGGGCGGGCGAGCTCGACCATCCCCTCTTGGGC
GCGCTGGTGCCCTTGCCCGAGTCCGGCGGCGGCCTCCTCACGGGCGTGCTCACGCTCGCC
GGACAGCCGTGGTTGGCCGAACACTCGGTGTCCGGTGTGGTGTTGTTTCCGGGGGCGGGG
TTTGTGGAGTTGGTGTTGCAGGCGGGGTTGTGGTTGGGGTGTGAGGTGGTTGAGGAGTTG
ACGTTGGAGGGGCCGTTGGTGTTTTCGGAGCGGGGTGGGGTTGAGGTTCAGGTGGTGGTG
GGTGGTGTGGGTGAGGGTGGTTGTCGGTCGGTGTCGGTGTTTTCGTGTCGTGGGGGTGAG
TGGGTTCGGCATGCGGTGGGTGTTTTGGGGGTGGGGGCTGGTGTGGTGTCCGGTGTGGAG
GTGGTGTGGCCGCCGGTGGGTGCGGTGCGGGTTGGGGTGGAGGGGGTTTATGAGGGGTTG
GCGGAGCGGGGGTATGTGTATGGGCCGGTGTTCCAGGGGCTGCGGGATGCGTGGCGTCGG
GGGGACGAGGTCTTCGTCGAGGCGGTGCTACCGGCGGACGCCCGGGGCGATGCGGCGCGT
TGCGCGATCCATCCAGCTCTGCTCGACGCCGCGCTGCACGGTATCGGCCTGGGGGCCCTG
ATCACCGACGACGGTCGGGCGTACCTTCCGTTCTCGTGGAGCGGGGTCAGGCTGCACGCG
GTCGGTGCGTCCGCTGTCCGGATGGCGCTGACGCCCGCCGGGCCGGACACGGTATCGCTG
AGGGTGACCGATGAGGCGGGTCAGCCGGTGCTTTCGGTGGACTCCCTCGTACTCCGCCCG
GTTGCGGACGGACAGCTCGCCGAAGCCGAGGTCGGCAACCGCGATGCGCTCTACCGGGTG
GAGTGGGTGGACGTAGGGGTGTGTTCGGTGGGGTCGTTGGTGGAGTGGGGAGAGGTGTCT
ACCGGTGGGGTGGTGCGGGAGTGTGTGGTGTTGTCGGGGGTTGATGTGGTGGGTGTGTTG
GAGGTTTTGCGGGCGTGGGTGCTGGAGGAACGTTTTGCGGGTTCGCGGTTGGTGGTGGTG
ACGCGGGGTGCGGTGTCGGTGGGTGGTGAGGGTGTGGAGGATGTGGGCGGTGGTGCGGTG
TGGGGGTTGGTGCGGTCGGCGCAGTCGGAGCATCCGGGGCGGTTTGTGCTGGTGGATGTT
GAGGAGGGCGTGGAGGGGGATGTGGTTCCGGATGTGGTGGGGTTGGGGGAGTCGCAGGTG
GCGGTGCGTGGGGGCCGGGTGTGGGTGCCGCGTCTGGTGGGTGTGAACGCGACTGATGTG
CGTCGGGGGTTGGGTTCGGGTGTGGCGTTGGTGACGGGTGGGACGGGGTTGTTGGGTGGG
TTGGTGGCGCGTCATTTGGTGTCGGTGTATGGGGTGGGCGAGTTGGTGTTGGTGAGTCGG
CGCGGGTGGGATGCGGCGGGTGCCGAGGCTTTGGTGGATGAGTTGCAGGGGTTGGGCGCG
CGGGTGCGCGTGGTGGCGTGTGATGTGGCGGATCGAGGTGCGGTGGCGGAGTTGGTGGGG
TCGATTGAGGGGTTGGGAGTGGTGGTGCATGCGGCGGGTGTGGTGGATGACGGAGTGATT
GGTTCTTTGGACGGGGGGCGGCTGCGTGGGGTGATGGAGCCGAAGGCTCTGGGGGCTTGG
CATCTGCATGAGTTGACGCGTGAGCTGGATCTGTCGGCCTTTGTGTTGTTCTCGTCGGCG
GCCAGTGTGTTGGGCAATGCGGGGCAGGGTGGTTATGCGGCGGCGAATGGGTTCCTGGAC
GTGCTGGCGGCTCATCGGCGGGCGCTGGGGCTGCCCGCGGTGTCGATCGCATGGGGCTTC
TGGGAAGAACGCAGCGAACTGACGGCCGACCTGGCCGAGGTGCAGCTGTCGAGGATCTCC
CGGTCCGTGGGCACCAGCATCAGCAGTGCACAAGGACTGGACCTGTTCGACGCGGCGCTC
GCCGCAGACGAGCCGATGGTGCTGGCCACGCCCCTGAACCTGCCGGCGTTGCGGGAACAG
GCCGCCGCGGGCACCTTGCCGTCGATCCTGAGTGGACTGGTCACGGCTCCCGTCCGCAGG
GCAGTCGATTCCGGGCGTACCCCGGCCGGACTCCGGCACCAACTCGCCGGGGTGACGGAG
GCCGAGAGGCAGAATCGGATCCTGCGCCTGGTGCGGGAACATGTGGCCGGCGTCCTGGGC
CACGCCTCCGCGGAGTCTGTCGACGCCTCGCGGACCTTCCAGGAGATCGGCTTCGACTCG
CTGACGGCGGTGGAACTGCGCAACCGGATCAGCGCCGCCATCGGCGTACGGCTGCCCGCC
ACCGCGGTCTTCGACCACCCCACCCCCCGGCTGCTGGCCGAGCGTGTGCTGGCCGAAGTG
TGGGGCTCACTGCCCACCGCCGCCCCGATCATGCCGGTGTCGGCCGTCGACGACGAGCCG
ATCGTGATCGTGGGCATGAGCTGCCGCTTCCCCGGTGGTGTCGGGTCTCCTGAAGACCTG
TGGCATCTGGTCAACTCGGCCACTGACGCGGTCTCCGCGTTGCCCACGGACCGGGGCTGG
GATCTGGCGACCTTGTCCGGCGGCAAGGGCGGTGCCGGTGCATCGTACGCTCAGGACGGT
GGATTCCTCTATGACGCGGCCGAGTTCGACGCCGGGTTCTTCGGGATCTCGCCGCGTGAG
GCGACCGCGATGGATCCGCAGCAGCGGCTGTTGCTGGAGACGGCCTGGGAGGTGTTCGAG
CGGGCCGGGATCGCCCCGGACACACTCAAGGGCAGTCGGACGGGCGTCTTCACTGGTGTG
ATGTACCACGACTACGGCTCGTGGCTCACCGATGTCCCGGACGATGTCGAGGGCTATCTG
GGCACAGGCATCGCGGGCAGTGTGGCGTCGGGACGGCTGGCCTACACGTTCGGGCTGGAG
GGGCCTGCCCTCACGGTGGACACCGCCTGCTCGTCATCGCTGGTGGCGTTGCATCTGGCG
GCCGAGTCGCTACGGCGCGGGGAGTGCTCGCTGGCACTCGCGGGCGGAGTCACCGTACTG
GCGACTCCGCAGGTCTTCGTGGAGTTCACCCGCCAGGGTGGGCTTGCACCGGACGGCCGG
TGCAAGTCCTTTGCCGCTGGTGCGGATGGGACGGGTTGGTCGGAGGGTGTGGGGCTGCTG
TTGGTGGAGCGGTTGTCGGATGCTGAGCGGAATGGGCATCGGGTGTTGGCGGTGGTGCGG
GGCAGTGCGGTGAATCAGGACGGTGCGTCGAATGGGTTGACGGCGCCGAACGGTCCGTCG
CAGCAGCGCGTGATCCAGCAAGCGCTGGCAAGCGCCGGGCTTGCAGCCCGGGACGTGGAC
GCGGTGGAGGCGCACGGTACCGGTACGACGCTGGGCGACCCCATCGAGGCGCAGGCTCTG
CTGGCCACCTACGGCCAGGACCGGGATCCGGGTCGGCCGCTGTGGTTGGGTTCGGTGAAG
TCGAATATTGGTCATACGCAGGCTGCGGCGGGTGTGGCTGGTGTGATCAAGATGGTGATG
GCGATGCGGCACGGGGTATTGCCGCGGACGCTGCACGTGGATGAGCCCTCCCCGCATGTG
GATTGGTCTGCCGGTGCGGTGGAGCTCCTGGGTGAGCACACGGCGTGGCCGGAGGCCGGG
CGACCCCGCCGGGCCGGAGTCTCGTCGTTCGGGGCGAGCGGTACCAACGCCCATGTGATT
CTGGAGCAGGCCCCTGACACGGCGAGCGAACCTGAACCAGGCCCGGCGCGGAGTGAACTA
CCGGCGATTCCCTGGGTGTTCTCCGCTCAGGACGAGGCGGGTGTGCGCGCACAGGCCGTA
CGGTTGCGGGCCTTCGCGGACCGGAACGCGGATTTGGATCCGGTGGATGTGGGGTGGTCT
TTGGCGGCCACCCGTGCCGGGTTGTCGCATCGTGCGGTGGTCGTGGGTGCGGATCGTGAG
GAGTTGCTGGGGGCTTTGGAGGGCGCGCCGGTGGTGGGTGTTCCGGTGGTGGGTGGACTG
GGTGTGTTGTTCGCGGGTCAGGGGTCGCAGCGGTTGGGGATGGGGCGTGGGTTGTATGAG
GCGTATCCGGTGTTCGCGGTGGCGTGGGATGAGGTGTGTGCCGAGCTGGACCGGTATGTG
GATCGGTCGGTGGGTGAGGTGGTGTGGGGTGATGATGCTGAGTTGATCGGGGAGACGGTG
TATGCGCAGGCGGGGTTGTTTGCGCTTGAGGTGGCGCTGTATCGGCTGATCGCTTCGTGG
GGTGTGAAGCCGGATTATCTGCTGGGTCATTCCATTGGTGAGTTGGCTGCCGCTTATGTG
GCGGGTGTGTGGTCGTTGGAAGATGCCGCCAGGGTGGTGGCTGCTCGGGGTCGTTTGATG
CAGGGGTTGCCCTCGGGTGGGGTGATGGTTGCGGTGGCCGCCTCCGAAGGTGAGGTGTTG
CCGCTGCTGGCGGATGCGGTGTCCGTTGCGGCGGTGAATGCGCCCGAGTCGGTGGTGGTC
TCGGGCGATGAGGATGCCGTGCGGGCCGTGGCGGATGTTCTCCGTGGGGTGCGGACCCGC
CGCGTTCGGGTGAGTCATGCCTTCCATTCGGCTCGGATGGACGGCATGCTGGCGGAGTTC
GGTGAGGTGCTGCTGGCCGGTGTCGAGTTCCACGCTCCGAGCCTGCCGGTGGTCTCGAAT
GTGACGGGTGAGGTGGCCGGTGAAGAGCTCTGCTCACCGGAGTACTGGGTGCGCCATGTG
CGGGAGACGGTCCGGTTCGCCGATGGGCTGGACACTCTCCGCGAGCTGGGTGTCGGTTCA
TTCCTGGAGTTGGGCCCCGATGGCACGTTGGCCGCGCTGACCGATGGCGATGGGCTGCCG
GTCCTGCGCCGGGATCGTCCGGAGCCCCTGTCTCTCATGGCTGCTCTGGGTGGGTTGTAT
GTCCGGGGTGTGGGGGTGGACTGGGGCGCGGTGTTCCCGGGTGGTCGGCGGGTCGATCTC
CCCACCTACGCGTTCCAACGGCAGCGGTTCTGGCTGGAGCCATCATCGGCTGAGCCCACG
ACGAGCGCTACGGACGCGGCGTTCTGGGCTGCGGTCGAGCGCGGGGACCTCGGATCGTTC
GGCATCGACGCCGAACAGCCGCTCAGCGCGGCGTTGCCTGCCTTGGCGTCGTGGCGGAGG
ACGCGGCAGGAGCAGTCGGTCATTGATGGGTGGCGTTACCGGCTCAGCTGGACGCCGATC
CCGGCGGTGTCCGGGGAGTCCGGCCTCACCGGCACCTGGCTGCTGGTGGTCGAGCCGGGT
GGTGGCGCCGATGACCTGGTGGGCGCGATGCGCGCGGCGGGGGCCGAGGTGCGGACGGTG
ACGGTGGCGGAGGTCGCCGAGGCGGCGCGGCTCGGGGCGCCGGAGACCGTGTCCGCCACG
GCGGGTGTGGTGTCGATGCTGCCCGTCGAGGAGACCGTCGCCGTGTTGCAGACGCTTCGT
ACGACTGCGCCGTTGTGGTGTGTGACTCGGGGTGCGGTGTCGGTGGTGGATGGGGATGTG
GTGGATCCGGTTCAGTCGGGGGTGTGGGGTCTTGGGCGGGTGATCGGGCTGGAGTATCCG
GATCGTTGGGGTGGTCTGGTTGATCTTCCGGGGGTTGTGGATGAGGAGGCTGGGGTGTGG
TTGTGTCGGGTGTTGGGTGGGGGTACGGGGGAGGATCAGGTTGCGGTTCGTGGTGGTGGG
GCGTGGGGTGCTCGGTTGGTTCGGGTGGTGGGTTCGGGGTTGGGTGGGTCGGTTGTGTGG
CGGGGTGGGGGGTCGGCGTTGGTGACGGGTGGTACGGGTGCGTTGGGTGGTCATGTGGCG
CGTTGGCTGGCGGGTGCTGGTGTGGAGAACATTGTGCTGGTGAGTCGTCGGGGGTTGGCT
GCGCCTGGGGTTTTGAGGTTGGTGGCGGAGTTGGAGGGGTTGGGCTCGGGGGTGCGGGTG
GTGGGGTGTGATGTGGGGGTTCGGGATCAGGTGGTGGGGTTGTTGGAGGGGATTGCGGAT
TTGCGGGTGGTGGTGCATGCGGCGGGTGTGCTGGATGACGGTGTGTTGGAGTCGTTGTCG
GCTGGGCGGGTTGGTGAGGTGTGGCGGGTCAAGGTTGAGGGTGCGTTGTATCTGGATGAG
TTGACCCGGGGTCGGGGTCTGGATGCTTTTGTGTTGTTTTCTTCGGCTGCGGGGACTGTG
GGTAGTGCGGGTCAGGGGAGTTATGCGGCGGCTAATGCTGCTCTGGATGGGTTGGCTTGG
CGGCGGCGGGCGCAGGGGTTGGTGGCCACGTCGGTGGCGTGGGGTGCCTGGGCCGACAGC
GGCATGGGTGCGGCCCAGCGGCAGCTCCCCGGCATGCCCCCGGAACTGGCGGTCGCCGCG
CTTCAGCAGTCACTGGTCGAGGACGAGACCGCACTGATGATCGCGGACGTGGAGTGGTCG
AGCTTCGGCTCCCGGTTCACCGCCGTAAGGCCGAGCCCGCTGCTCAGCGAACTGCTGCCC
CTCGCCACCACGCCGATGGAACCGGTTGAGGAACTCGCCACTCGGCTGCGGGACATGTCA
CGGCTCGAGCGCGATCGGGCGGTGCTGGAGCTGGTCCGTGCCCAAGTGGCGGCCGTACTG
GGCCATGCGAAGCCCGCTTCCGTCGACCCCTCGCGGACCTTCCAGGAAGTCGGCTTCGAC
TCGCTGACCGCGGTGGAGCTGCGGAACCGGCTGGCCACCGCCACCGGCGTGCCCTTCCCG
GCGTCCGTCATCTTCGACTATCCGACTCCCGCGGCGCTCGCCGACCATGTCCGTACCCGG
TTCGTCCCGGACGAGGGCGAGGACGGGGCCGGGGGCGGCACGACGTCCGTACTCGCCGAG
TTGACCAGGCTGGAAGCCGCGCTGTCCGACCTGTCCCCGACCGACATGGCCGGTGCCGAG
GTCGCGGCGAAGATCAAGAGCCTGCTGTCCCACTGGGGCGCGGCCACCAACAGTGACATC
GAAGTGGATTCCGCCACGGACGAGGAGATGTTCGACCTCCTCGGCAAGGAGTTCGGGATC
TCGTGA
[0] KSQ24..412
[0] AT577..897
[0] malonyl-CoA771..775
[0] ACP974..1044
[1] KS1067..1440
[1] AT1594..1903
[1] methylmalonyl-CoA1773..1777
[1] KR2158..2334
[1] ACP2432..2502
[2] KS2530..2901
[2] AT3047..3354
[2] methylmalonyl-CoA3226..3230
[2] DH3396..3554
[2] KR3827..4004
[2] ACP4107..4177
[3] KS4198..4574
[3] AT4723..4991
[3] malonyl-CoA4906..4910
[3] KR5304..5480
[3] ACP5568..5638
[0] KSQ70..1236
[0] AT1729..2691
[0] malonyl-CoA2311..2325
[0] ACP2920..3132
[1] KS3199..4320
[1] AT4780..5709
[1] methylmalonyl-CoA5317..5331
[1] KR6472..7002
[1] ACP7294..7506
[2] KS7588..8703
[2] AT9139..10062
[2] methylmalonyl-CoA9676..9690
[2] DH10186..10662
[2] KR11479..12012
[2] ACP12319..12531
[3] KS12592..13722
[3] AT14167..14973
[3] malonyl-CoA14716..14730
[3] KR15910..16440
[3] ACP16702..16914

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [568-698]  G3DSA:3.40.366.10 [771-886]  G3DSA:3.40.366.10 [1590-1714]  G3DSA:3.40.366.10 [1773-1893]  G3DSA:3.40.366.10 [3043-3167]  G3DSA:3.40.366.10 [3226-3343]  G3DSA:3.40.366.10 [4722-4840]  G3DSA:3.40.366.10 [4904-4995]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1002-1017]  PS00012 [2460-2475]  PS00012 [4135-4150]  PS00012 [5596-5611]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [978-1043]  1e-09 PF00550 [2435-2501]  1.9e-12 PF00550 [4110-4176]  7.4e-13 PF00550 [5571-5637]  7.79999999999999e-14 PF00550
PF00550   PP-binding
 [967-1083]  1.20000117458134e-24 SSF47336 [2425-2547]  5.10001002358244e-27 SSF47336 [4100-4215]  1.10000150671642e-28 SSF47336 [5559-5645]  9.5000102816722e-23 SSF47336
SSF47336   ACP_like
 [974-1044]  PS50075 [2432-2502]  PS50075 [4107-4177]  PS50075 [5568-5638]  PS50075
PS50075   ACP_DOMAIN
 [973-1048]  8.80000000000003e-90 G3DSA:1.10.1200.10 [2431-2505]  8.80000000000003e-90 G3DSA:1.10.1200.10 [4104-4179]  8.80000000000003e-90 G3DSA:1.10.1200.10 [5567-5640]  8.80000000000003e-90 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2158-2333]  5.19999999999996e-58 PF08659 [3827-4003]  2.99999999999998e-55 PF08659 [5304-5479]  7.4e-53 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [24-289]  1.29999999999998e-77 PF00109 [1067-1314]  1.5e-96 PF00109 [2530-2775]  7.79999999999999e-92 PF00109 [4198-4448]  1.5e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [297-412]  6.80000000000006e-39 PF02801 [1322-1440]  3.60000000000002e-48 PF02801 [2783-2901]  1.09999999999999e-49 PF02801 [4456-4574]  8.89999999999994e-50 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [577-897]  1.70000000000001e-62 PF00698 [1594-1903]  2.09999999999996e-98 PF00698 [3047-3354]  1.20000000000001e-96 PF00698 [4723-4991]  5.30000000000001e-55 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-870]  4.40002866058555e-72 SSF52151 [1592-1895]  3.89999861795218e-67 SSF52151 [3045-3335]  8.39998014024973e-65 SSF52151 [4719-4995]  3.10001307370203e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [700-770]  5.7999965385478e-14 SSF55048 [1716-1772]  5.09999882439978e-11 SSF55048 [3169-3225]  8.90000829418053e-11 SSF55048 [4845-4905]  3.50000235434314e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [24-64]  G3DSA:3.40.47.10 [101-300]  G3DSA:3.40.47.10 [301-464]  G3DSA:3.40.47.10 [1069-1326]  G3DSA:3.40.47.10 [1327-1491]  G3DSA:3.40.47.10 [2533-2787]  G3DSA:3.40.47.10 [2788-2953]  G3DSA:3.40.47.10 [4198-4459]  G3DSA:3.40.47.10 [4460-4626]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [16-409]  2.59998233910302e-90 SSF53901 [1059-1490]  1.09999184471405e-103 SSF53901 [2523-2953]  6.90004508941104e-101 SSF53901 [4191-4626]  5.50001754266469e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2158-2339]  1.39999999999997e-93 G3DSA:3.40.50.720 [3827-4005]  4.49999999999996e-96 G3DSA:3.40.50.720 [5304-5499]  1.39999999999997e-106 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1227-1243]  PS00606 [2688-2704]  PS00606 [4361-4377]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [578-877]  3.699978135861e-121 SM00827 [1596-1884]  1.59998835313644e-115 SM00827 [3049-3334]  4.80002938964646e-113 SM00827 [4723-5006]  1.79999754022378e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [975-1047]  4.40000933643891e-30 SM00823 [2433-2505]  1.99999636034521e-33 SM00823 [4108-4180]  1.40000506907309e-33 SM00823 [5569-5641]  1.10000150671643e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3396-3554]  7.19996395544006e-70 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [26-465]  SM00825 [1069-1490]  SM00825 [2533-2953]  SM00825 [4201-4626]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2158-2334]  4.60000044330862e-51 SM00822 [3827-4004]  1.49999648196323e-46 SM00822 [5304-5480]  1.49999648196323e-46 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit