close all open/close all

CDS information : Merid_00030


close this sectionLocation

Organism
StrainDSM 4137
Entry nameMeridamycin
Contig
Start / Stop / Direction29,830 / 51,366 / + [in whole cluster]
29,830 / 51,366 / + [in contig]
Location29830..51366 [in whole cluster]
29830..51366 [in contig]
TypeCDS
Length21,537 bp (7,178 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MerB
Gene
Gene (GenBank)merB
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[17159202] Organization of the biosynthetic gene cluster in Streptomyces sp. DSM 4137 for the novel neuroprotectant polyketide meridamycin. (Microbiology. , 2006)
Related Reference
ACC
Q1WEK8
PmId
[16806745] Isolation and characterization of meridamycin biosynthetic gene cluster from Streptomyces sp. NRRL 30748. (Gene. , 2006)

close this sectionPKS/NRPS Module

4 ethylmalonyl-CoA
5 methylmalonyl-CoA
6 methylmalonyl-CoA
7 methylmalonyl-CoA
KS34..406
AT556..876
DH921..1083
KR1360..1540
ACP1640..1710
KS1734..2110
AT2292..2600
KR2944..3120
ACP3226..3296
KS3321..3699
AT3851..4160
DH4208..4368
ER4712..5016
KR5025..5202
ACP5300..5370
KS5393..5770
AT5918..6225
DH6272..6431
KR6747..6924
ACP7024..7094

close this sectionSequence

selected fasta
>polyketide synthase [MerB]
MENEEKLRHYLKEVTKDLRQTRQRLEDIEAKSREPIAIIGMSCRFPGGIATPEALWDLVR
EGGDAVSDFPTDRGWDTEDLYDPAGGSGKSVTRYGGFLHGIADFDAALFGISPREAIAMD
PQQRLMLETSWEAFERAGVHRDAVRGSRTGVFIGTNGQDYATLLSAARDEVQGHLGTGSA
ASVLSGRVAYTFGLEGPTVTVDTACSSSLIALHLAVQALRNGECELALAGGVTVMTTTNT
FVELSKQGGLAPDGRSKAFAAAADGTGWGEGAGVLLVERLSDAERHGHPVLAVVCGTAAN
QDGASNGLTAPNGPAQRRVIRAALSNAQLSTGDVDVVEAHGTGTRLGDPIEAQALLDTYG
QDREQPLWLGSVKSNLGHAQAAAGVAGASDGLAMRHGVLPRTLHVDEPTPHVDWSAGAIR
LLTERTPWPETDRPRRAGVSAFGVSGTNAHVIVEQAPETEPIEPSRIEPVAVPCVLSGQG
EAGLRAFAARLADVATEAHPGDLGWTLATTRSALSHRAVVIGSTPADLRSGLAAVAAGEP
APNVVEGVAGPDTGVVLVFPGQGSQWAGMAVELLDTSPAFARRFAECARALEAHLDWSIE
DVVRSVPGAPSLDLIEVVQPVLFTMMVSLAELWSSYGITPSAVVGHSQGEIAAACVAGAL
SLEDAAKVVVLRSRLFAETLVGNGAIASVALPAEQLATRIEPWGERLAVAGVNGPAAATV
AGDPQSLEEFVAACVADGVRARVVPATVASHGPQVEPLRERLLALLADVAPRQSTVPFYS
TVTGGLLDTTELDADYWFWNARKPIDFLGALHALFADGHRFFVESSTHPALTMGIQDTAD
ASGESVVVTGSLRRGEGGLAQFCSAVARLHVHGVRVDWPAAFGAARRVELPTYPFQRERY
WLTPRPGHGDASALGLGALDHPLLGATAVLPESGGCLLTGRLSLATHPWLADHALSGVVL
FPGAGFVELVLQAGLWLGCGVVEELTLEGPLVFSERGGVEVQVVVGGVGEGGVGGGGCRS
VSVFSCRGGEWVRHAVGVLGVGAGVVSGVEVWPPVGAVRVGVEGVYEGLAERGYVYGPVF
QGLRDAWRRGDEVFVEVAVPAEARGDAARCAIHPALLDAALHGVRFGDFVSDDDQAYVPF
SWTGVTLNAVGATALRVTLSPAGRDAIALRATDTTGAPVLSARSLALRPLSAQQLDDTRG
SRTDALHRVEWVDASGAVAAGGEVASRTEVVRVVSEGADVVGEAYGHVLGVLERVRAWVG
DEDLAGERLVVVTRGAVDVGGGVEDVAGAAVWGLVRSAQSENPGRLVLVDTDDVEGVGGV
LPGVLALGEEQVVVRSGVVRVPRLGRVRVSGEVSGVFGSGAVLVTGGTGVLGGVVSRHLV
VRHGVSRLVLLSRRGAEAEGAAELRAELEGAGAEVVIAACDAADGEALAGVLAGLPEGFA
LSGVVHAAGVLDDGLLTSLTRERVEPVLRAKVDAAWNLHELTAGMNLSALVFFSSAAGVL
GNAGQSSYAAANGFLDALAAHRRARGLPAVSIAWGFWEERSELTKHLSADDLARAHAVPM
PTSQALDLFDAALAADEAMVLAAPLDPRAWSDADNPPAVLRDLVRPRIRRAAEVVDASGS
ASALEHRLAAVDRSEWDQVVRELVRNHIAAVLRHASAESVDTSRTFQEIGFDSLTAVELR
NRISAATGVRLPATAVFDYPTPRALADHLLAEALGKDIGAAAATPAGAALVADDPIVIVG
MSCRYPGGITSPEALWDLVRSGGDAISALPTDRGWDLDGLYDPDPDRPGRSYARSGGFVY
DAAEFDAAFFGISPREAAAMDPQQRLLLEASWEAFERAGIPATSVKGERIGVFTGVMHHD
YLTRLSITPDGVEGYLGTGAAAGVASGRVAYTFGLEGPAVTVDTACSSSLVALHLAIQAL
RLGECSLALAGGVTVMSTPTVFVEFSRQRGLASDGKCKAFAGAADGTGFAEGIGMLLVER
LSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASAGLSAVDVDAVEA
HGTGTTLGDPIEAQALLATYGQGRDADRPLLLGSIKSNIGHTQAAAGVAGVIKMVMAMGH
GVLPQTLHIDEPTPHVDWSTGAVRLLGEHTEWPEAGRPRRAGVSSFGISGTNAHLILEQA
PLPTTAERPDDAEPGDAKSGDVRPGDVRPDDVRPRAAGPGAVVPWILSGRDRRALRAQAE
RLRAHVASHPDLSVADIGFSLLTSRAVLEHRAVVLGGDHAELSAGLTALAQDEPAPGVVE
ALDAAEPGRKVVFVFPGQGSQWAGMALELLESAPVFARRMGECAEALAPLVEWSLPDVLA
DERALGRVDVVQPVLWAVMVSLAELWRSYGVAPSAVVGHSQGEIAAACVAGGLSLADGAR
VVVLRGKALLALSGRGGMVSVPVPADRLRDRPGVSIAAVNGPSSTVVSGGDEALDAVLVE
FPAAKRIPVDYASHSPQIDGIRDELLKALAPIEPRTAAIPFHSTVTGRPIDTAELDADYW
YRNLRETVELERVTRAAVEDGHHTFIEISPHPVLTTGLRETLDDADAHGGLVLASLRRDD
GGLTRFRTALAEAYAYGVEVDWLSVFPGARRVELPTYAFQRERYWLDAPTAEAPTSAIDA
EFWAAVEREDLESLAATLRVDGQPLREVLPALSQWRRERRDVSTIDSWRYKIRWKPLTPP
ATCPTGTWLVVVSHAEAEHEWVAGVTGALTRHGAEPLVVVLGEPELDRAALAARLGAALA
DTPRVSGVVSLTALDESPHPAYPSVPQGYAMTLLLSQALGDAGVEAPLWCLTQRGVSLGD
GGGNRGGAGGRGDEGNGSGNGNSTGSGSGNGPGEGDGDRDVAVSRKQALTWGLGKVIALE
QPLRWGGLIDLPEGVAPYAQDYLVGVLAGTSDEDQVAIRPTGLFGRRLAHAPAPERGGAW
QPRGTVLVTGGTGALGGHVARWLAAQGAEHVVLTSRRGMAAPGAERLAGELEALGARVTV
AACDVGDRDALAALLTEVGPLTAVVHTAAVLDDATLNSLTTEQLQRVLRVKTDGAVHLHE
LTRDMELSAFVLFSSLSGTLGAPGQGNYAPGHVFVDTLAEQRRAEGLVATSIAWGLWAGD
GMGEGGVGEVARRHGVPEMAPEMAVAAMARAVEQDDTVVTVAEIDWDRHYVAFTATRPSP
LLSDLPEVRALIDAGVGQESAEPGHERSEFAERLAGMADADRNRALLDLVRRHVAVVLGH
TGPDAIDPGRAFHEIGFDSVTAVELRNRLNRATGLRLPATVTFDQPTPLAMARYLRGELL
HDGQDRSAPARPVRTTGAVDDEPIAIVGMSCRFPGDVASPEDLWRLLADGSDAIGEFPEN
RGWDTAHLFHPDPDHRGTSSTRAAAFVSGAGEFDAGFFGISPREAVAMDPQQRLLLEVSW
EALERAGIDPSTLRGSETGVFTGTNGQDYASLLKADETGDFEGRVGTGNSASVMSGRISY
VLGLEGPALTVDTACSSSLVALHLAVRALRSGECSLALAGGASVMTTTGIFVEFSRQRAL
AADGRCKAFAAGADGTGWGEGVGMLVVERLSDAERNGHRVLAVVRGSAVNQDGASNGLTA
PNGPSQQRVIRQALASAGLSAVDVDVVEAHGTGTTLGDPIEAQALLATYGQGRDVDRPLL
LGSIKSNIGHTQAAAGVAGVIKMVMAMGHGVLPQTLHIDEPTPHVDWSTGAVRLLDEQTD
WPETARPRRAGVSAFGVSGTNAHVILEQAPAPTAEPELSPERDETRAVPWVVTGASEAGV
RAQAARLMAFVDDRPELRPVDIGWSLVSTRAALPHRAVVVGGDRDELVRELEAVAGGSAA
IGEARTHSGVVFVFPGQGSQWVGMALELVESSSVFAGRLGECADVLAPLVEWSLWDVLGD
EVALSRVDVVQPVLWAVMVSLAELWRSFGVVPSVVVGHSQGEIAAACVAGGLSLEDGARV
VALRSRALLALSGRGGMVSVPVPADRLRDRPGLSVAAVNGPVSTVVSGSVEALDAVLEEF
PEAKRIPVEYASHSVQVEEIREGLAEALASVRPRTGEVPFYSTVTGRLMDTVELDAEYWY
RNLRETVEFRSAVEGLLELGHTVFVEASPHPVLTVGIQDTADATDTTHTDILVTGSLRRD
DGGLVRFLSTVGRLFTAGVPVEWQPLFAAAGARRVDLPTYAFQHEWFWLDPVRGASDVGG
AGLAGLAHPLVSAVLPLPESDGCVLTGSLSSATHPWLRDHAVLDKVLLPGTGFVELALQA
GLHLGCRTLDELTLQAPLVLPAHGDVQIQVAVGGPDDSGRRPVTVYSRPGQDRTWVRHAT
GSVSPGGETATVDRTVWPPVDATPVDLTGVYAEMNTRGYAYGPVFQGLRAAWRRGDEVFA
EVVLSETAESDAGRCAVHPALLDAALHGAGLGTFVTEPGRPHLPFAWTGVSLHAVGATTL
RVVLSPAGPDAISLLAMDGTGAPVLTADSLALRPVSGGTRGGAHNDSLFRVDWTELALAA
SDTSDEVAFPVVESLAQLTGPGAPQPVHGAVVFRPFATEASATEAPATEASVAGATDATG
AADTTEENPEDVYALTSRVLEVAQAWLADDRFGDARLVVVTRGAVATRPGEDPESLAAAA
VWGLIRTAQTENPGRFVLVDTVDEDPSVSSVSSVSSTSSVVSALPAVLATDEPQVAIRAG
KALVPRLVRAASSALPVPAETDTWRLEADGQGTLENLVLAPHAEASRPLATHEIRVAVRA
AGVNFRDVLLALGMYPDKAGLLGSEAAGTVLEIGSGVAGVAPGDRVMGLFSGAFGPVAIT
DHRLVAPIPAGWSFPQAAATPIAFLTAMYALIDLADVRSGESVLVHAAAGGVGMAAVQVA
RWLGAEVFATASPAKWDAVRACGVAQQRIASSRSTEFADRLRSDAPGGVDVVLNSLTGEL
LNASLGLLRPGGRLIEMGRTDLRDAEEVMARHGVSYRAFELLDAGPDRIGRLLTELLSLF
RQGVFTPLPLRVQDVRQASDAFRHLSQARHIGKLALTIPRPLSGGTALITGGTGTLGGLV
ARHLVREHGVTELVLVGRRGDTAPGAAELLTELEAAGARVRVVACDVSDREATAALVASL
PNLRSVVHTAGVLDDAVIGSLTPERLRTVLRPKADAAWHLHELTRDRDLAEFVLFSSAAG
VLGGPGQGNYAAANAFLDALAARRRAQGLPATSLAWGFWEQRSGLTEHLTTDRLARSGVL
PLSTDEGLALFDAARATGDTLLVPMRYEPSAPGPEPVPALLRGLVRAPLARALPGPADGV
GNGVTEGLTGLAVDERLGVLLDLVRREAAAVLGHGGPQSVTPRRPFKELGFDSLSAVELR
NRLRTATGRRLEATLIFDHPTPAALARHLDAELFGATDVAAPVPAPTVAHPADERIAIVG
MSCRLPAGVDSPEALWTLLMSGTDAISELPTDRGWSLDALYDQDPSRPGTTYAKTGGFLK
NAADFDAGFFTISPREALAADPQQRLWLEACWEAFERAGIDPLALKGTRTGVFAGAASTT
YGAGQAAAPDGSEGYLLTGNSTSVISGRVAYTLGLEGPAVTVDTACSSSLVSVHWACESL
RRGESTLALAGGVAVMTTPDLLVEFSRQRGLAPDGRCKSFAAAADGTGFAEGAGVLVLER
LSDAERNGHQVLAVIRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLASQEVDAVEA
HGTGTTLGDPIEAQALLATYGQDRDPDRPLLLGSVKSNIGHTQAAAGAAGLIKMVLALRN
GVLPRTLHVDEPSPHVDWSAGAMELLTEQTTWPDRDRPRRAGVSAFGVSGTNAHVILEQA
PKPDENGEPDTGRSGLPAVPWVLSGAGAAGLRAQAQRLASFVRENPELDPVDVGWSLVAT
RAALSHRAVVVGADRTELLRELDAVQSVGAAEAGRDVVFVFPGQGSQWVGMALELVESSS
VFAGRLGECADVLAPLVEWSLWDVLGDEVALSRVDVVQPVLWAVMVSLAELWRSFGVVPS
VVVGHSQGEIAAACVAGGLSLEDGARVVALRSKALLALSGRGGMVSVPVSADQLRDRPGL
SVAAVNGPVSSVVSGPVEVLDAVLEEFPEAKRIPVDYASHSSQVEEIRGELAEALVSVRP
RTGEVPFYSTVTGRLMDTVELDGEYWYRNLRETVEFQSTVEHLMREGHTVFVEASPHPVL
TVGIQDTADATVTDIVITGSLRRDEGGVRRFLTSLAEVSVRGVEVNWWTAFDGAGARRVD
LPTYAFQRERFWLAPSTGTGDAYGLGLGAVDHPLLGAAVPLPDADGCVLTGALSLAGQPW
LADHSVLGMVLLPGTAFVELALQAGARFGCDTLEELTLHEPLVLPEQETVQLQVSVGGPD
DLGSRPFTVFSRREGDWTRHAGGTLCVGEHGDPPANPSVWPPADARPVDVAELHMTMAER
GYQYGPAFQGLRKAWIRDSEVFLDVALPELVRGDAARCGVHPALLDAALQGIGLGAFVSE
PGRAHLPFSWSGVTLHAVGATTVRVTLSPAGPDAVAIRMTDTIGAPVLSIDVLAMRPLAE
QRLLEAGGPRGDALFRLDWTELPVPTGATGPRALSWGLLGGHDEPRLTAALTAVGVSPQR
HRDLASIDQVPDVLVLPCLPEADDGPAPEATSSTLGRVLEVVREWLGDARYTDTRLVVLT
RRAVATSTGDDVEDLAAAAVRGLLRTAQQENPDRLVVIDHDDSDLGVLPAVLATGEPEAA
IRAGTVLVPRLVKAAVPDGKTPAWDTGTVLITGGTGTLGGLVARHLVTTHGARDLVLASR
GGDTAPGAVELATELEALGASIRVAACDVADRAQLTALLDTIPALRAVVHTAGVVDDGVI
GSMTADRVEAVLRPKANAAWHLHELTRRLDLDAFVLFSSATGVLGSAGQGNYAAANAFLD
ALAVHRRAQGLPAVSVAWGLWEQRSGLTAHLSEQDMARMTRTGAIPLSDERGLELFDAVC
RSGEATLVATPLHLRAVAATGTVPPVLSALAPAPPRRATEAGDGGVALRQSLAELSGAEQ
SQAVRELVRGQVAAVLRHPDGSAIDPVRTFQEIGFDSLTAVELRNRLGASTGIRLAATAI
FDYPTPATLAEHLLAEIVPETADPVAARLGELDKVAAMISAMGEDDTLREQLSSRMETIV
AMWADLHRPERSSRVGRDLESASLDDMFGIIDQELDGS
selected fasta
>polyketide synthase [MerB]
GTGGAGAATGAAGAGAAACTTCGTCACTACCTCAAAGAGGTCACGAAGGATCTGCGGCAG
ACCCGTCAGCGCCTTGAGGACATCGAGGCGAAGAGCCGCGAGCCCATCGCGATCATCGGC
ATGAGCTGCCGTTTCCCCGGTGGCATCGCAACACCGGAAGCGCTGTGGGACCTGGTGCGC
GAGGGCGGCGACGCGGTGTCGGACTTCCCGACCGACCGCGGATGGGACACGGAGGACCTC
TACGACCCCGCGGGCGGCTCCGGCAAGTCCGTCACCCGCTACGGGGGATTCCTGCACGGC
ATCGCCGATTTCGACGCCGCGCTCTTCGGGATCTCCCCCCGCGAGGCCATCGCGATGGAC
CCACAGCAGCGGTTGATGCTGGAAACCTCCTGGGAGGCGTTCGAGCGGGCCGGTGTCCAC
CGTGACGCGGTGCGGGGCAGCCGGACCGGAGTGTTCATCGGCACCAACGGCCAGGACTAC
GCCACGCTGCTCAGCGCTGCCCGCGACGAGGTGCAGGGCCACCTCGGCACGGGCAGCGCG
GCGAGCGTGCTCTCGGGACGGGTCGCCTACACCTTCGGTCTCGAAGGGCCGACGGTCACC
GTGGACACGGCGTGTTCCTCCTCGCTGATCGCCCTACACCTGGCCGTTCAGGCACTGCGC
AACGGGGAGTGCGAGCTGGCGCTGGCGGGCGGTGTCACGGTGATGACGACGACGAACACC
TTCGTCGAGCTGTCCAAGCAGGGTGGGCTGGCGCCGGACGGCCGGTCCAAGGCGTTCGCG
GCGGCGGCGGACGGCACCGGCTGGGGCGAGGGCGCCGGGGTGCTGCTGGTGGAGCGGCTG
TCCGACGCCGAACGCCACGGTCACCCGGTGCTGGCGGTGGTGTGTGGCACCGCCGCCAAC
CAGGACGGCGCCTCGAACGGGCTGACCGCGCCCAACGGGCCCGCCCAGCGCCGGGTCATC
CGCGCGGCACTGTCCAACGCCCAGCTGTCCACGGGCGATGTCGACGTGGTGGAGGCACAC
GGCACCGGCACCAGGCTCGGGGACCCGATCGAGGCACAGGCCCTGCTGGACACCTACGGT
CAGGACCGGGAGCAGCCGCTGTGGCTCGGATCGGTCAAGTCGAACCTGGGACACGCCCAG
GCCGCCGCGGGCGTCGCCGGGGCATCAGATGGCCTCGCCATGCGGCACGGTGTGCTGCCG
CGCACCCTGCACGTGGACGAACCGACCCCGCACGTGGACTGGTCCGCCGGTGCGATACGG
CTGCTCACCGAGCGGACCCCGTGGCCGGAGACCGACCGGCCGCGCAGGGCCGGGGTCTCC
GCCTTCGGGGTGAGTGGCACCAACGCCCATGTGATCGTGGAGCAGGCACCGGAGACCGAG
CCCATCGAGCCGTCCAGGATTGAACCGGTGGCGGTGCCCTGCGTGCTTTCGGGCCAGGGC
GAGGCCGGTCTGCGCGCGTTCGCGGCCCGGCTCGCCGACGTGGCCACCGAAGCGCACCCC
GGCGACCTCGGATGGACCCTGGCCACCACGCGCTCGGCCCTGTCGCACCGTGCGGTGGTG
ATCGGGTCCACACCGGCGGACCTGCGGAGCGGCCTCGCGGCGGTGGCCGCCGGAGAGCCG
GCCCCGAACGTGGTGGAGGGAGTGGCCGGTCCCGACACCGGTGTGGTCCTCGTCTTCCCG
GGACAGGGCTCGCAGTGGGCCGGTATGGCCGTGGAATTGCTGGACACCTCCCCAGCCTTC
GCCCGCCGGTTCGCCGAATGCGCCCGTGCCCTGGAGGCGCACCTCGACTGGTCCATCGAG
GACGTGGTGCGCTCCGTGCCCGGTGCGCCCTCGCTCGACCTCATCGAGGTCGTCCAGCCG
GTGCTGTTCACCATGATGGTGTCCCTCGCCGAGCTGTGGTCCTCCTACGGGATCACTCCC
TCGGCCGTGGTCGGCCACTCCCAGGGTGAGATCGCGGCGGCCTGTGTGGCCGGGGCGCTG
TCGCTGGAGGACGCGGCCAAGGTGGTGGTGTTGCGCAGCCGCCTCTTCGCCGAAACGCTG
GTGGGCAACGGCGCTATCGCGTCGGTCGCCCTGCCGGCGGAACAACTGGCCACCCGGATC
GAGCCGTGGGGCGAGCGCCTCGCGGTGGCCGGGGTGAACGGGCCAGCGGCGGCCACGGTG
GCCGGTGACCCGCAGAGCCTCGAGGAATTCGTCGCCGCATGCGTGGCGGACGGCGTACGC
GCCCGTGTCGTGCCCGCCACCGTGGCGTCCCACGGCCCGCAGGTGGAACCGCTGCGTGAA
CGGCTGCTCGCCCTGCTGGCCGACGTGGCGCCACGCCAGTCCACCGTTCCGTTCTACTCC
ACGGTGACCGGCGGGCTTCTGGACACCACGGAACTCGACGCGGACTACTGGTTCTGGAAC
GCCCGTAAGCCGATCGACTTCCTCGGCGCGCTCCACGCGCTGTTCGCCGACGGCCACCGC
TTCTTCGTGGAGTCGAGCACCCACCCCGCCCTGACCATGGGCATCCAGGACACGGCGGAC
GCCTCCGGTGAATCCGTGGTGGTCACCGGCTCGCTACGGCGTGGCGAGGGAGGGCTCGCC
CAGTTCTGTTCGGCCGTGGCGAGGCTGCATGTGCACGGCGTACGAGTGGACTGGCCGGCG
GCCTTCGGCGCGGCGCGGCGGGTGGAGCTGCCGACCTACCCCTTCCAGCGGGAGCGTTAC
TGGCTGACGCCCCGGCCCGGCCACGGTGACGCCTCCGCCCTGGGACTCGGCGCGCTCGAC
CACCCCCTGCTGGGGGCCACGGCCGTGCTGCCGGAGTCCGGTGGCTGCCTGCTCACCGGC
CGGCTGTCCCTGGCCACCCACCCCTGGCTGGCCGATCACGCCCTCTCCGGTGTGGTGTTG
TTTCCGGGGGCGGGGTTTGTGGAGTTGGTGTTGCAGGCGGGGTTGTGGTTGGGGTGTGGG
GTGGTTGAGGAGTTGACGTTGGAGGGGCCGTTGGTGTTTTCGGAGCGGGGTGGGGTTGAG
GTTCAGGTAGTGGTGGGTGGTGTGGGTGAGGGTGGTGTGGGTGGGGGTGGTTGTCGGTCG
GTGTCGGTGTTTTCGTGTCGTGGGGGTGAGTGGGTTCGGCATGCGGTGGGTGTTTTGGGG
GTGGGGGCTGGTGTGGTGTCGGGTGTGGAGGTGTGGCCGCCGGTGGGTGCGGTGCGGGTT
GGGGTGGAGGGGGTTTATGAGGGGTTGGCGGAGCGGGGGTATGTGTATGGGCCGGTGTTC
CAGGGGCTGCGGGATGCGTGGCGTCGGGGGGACGAAGTCTTCGTCGAGGTGGCGGTACCG
GCGGAGGCTCGGGGCGATGCGGCGCGTTGTGCGATCCATCCCGCTCTCCTCGACGCCGCG
CTGCACGGGGTGCGATTCGGCGACTTCGTATCCGACGACGACCAGGCTTATGTGCCGTTC
TCGTGGACCGGCGTCACTCTGAACGCGGTCGGTGCGACGGCGCTGCGCGTCACGCTGTCC
CCGGCCGGCCGCGACGCGATCGCCCTCCGGGCCACCGACACCACCGGCGCGCCGGTCCTG
TCGGCGCGCTCACTGGCCCTGCGCCCGCTCTCCGCCCAACAGCTGGACGACACGCGGGGG
AGCAGGACTGATGCCCTCCATCGGGTGGAGTGGGTGGACGCGTCTGGGGCTGTGGCGGCC
GGGGGTGAGGTGGCATCGCGGACCGAGGTGGTGCGAGTGGTCTCCGAGGGTGCGGATGTG
GTGGGTGAGGCGTATGGGCATGTGCTTGGGGTGTTGGAGCGGGTGCGGGCGTGGGTGGGG
GATGAGGATCTGGCGGGTGAGCGGTTGGTGGTGGTGACGCGGGGTGCTGTTGATGTGGGT
GGTGGTGTGGAGGATGTGGCCGGGGCGGCGGTGTGGGGTTTGGTGCGGTCCGCGCAGTCG
GAGAATCCGGGGCGTCTGGTGCTGGTGGATACCGATGATGTGGAGGGTGTGGGTGGTGTT
CTGCCCGGGGTGTTGGCTCTGGGTGAGGAGCAGGTGGTGGTGCGTTCGGGTGTGGTGCGG
GTGCCGCGTCTGGGTCGGGTGCGGGTGTCGGGTGAGGTGTCGGGGGTGTTTGGTTCGGGT
GCGGTGTTGGTGACGGGTGGTACGGGTGTGTTGGGTGGTGTGGTGTCGCGGCATCTGGTG
GTGCGGCATGGGGTGAGCAGGCTGGTGTTGCTGTCGCGTCGTGGTGCGGAGGCCGAGGGT
GCCGCGGAGTTGCGGGCGGAGTTGGAGGGGGCGGGTGCCGAGGTGGTGATCGCGGCGTGT
GATGCCGCGGATGGTGAGGCTTTGGCCGGGGTGTTGGCCGGGTTGCCGGAGGGTTTTGCG
CTTAGTGGTGTGGTGCATGCGGCGGGTGTGCTGGATGACGGGTTGCTGACGTCGTTGACG
CGTGAGCGGGTTGAGCCGGTGTTGCGGGCGAAGGTGGATGCGGCGTGGAATCTGCATGAG
CTGACGGCCGGGATGAACCTGTCGGCGCTGGTGTTCTTCTCGTCGGCCGCGGGTGTTTTG
GGCAACGCGGGCCAGAGCAGTTATGCGGCGGCGAACGGCTTCCTGGACGCGCTGGCGGCT
CATCGGCGGGCGCGGGGGCTGCCCGCGGTGTCGATCGCATGGGGCTTCTGGGAAGAACGC
AGCGAACTGACCAAGCACCTGTCGGCCGACGATCTGGCGCGTGCTCACGCGGTGCCGATG
CCCACCTCCCAGGCACTGGATCTGTTCGACGCGGCACTCGCCGCAGACGAGGCCATGGTC
CTGGCCGCACCGCTGGACCCCCGGGCATGGTCGGACGCGGACAACCCGCCCGCCGTCCTG
CGCGACCTGGTCCGGCCGCGGATCCGGCGTGCGGCCGAGGTAGTCGACGCCTCCGGATCG
GCCTCCGCGCTCGAACACCGGCTGGCCGCCGTGGACCGTTCCGAGTGGGACCAGGTCGTA
CGCGAACTCGTGCGCAATCACATCGCGGCGGTGCTGCGCCATGCCTCCGCGGAGTCGGTC
GACACCTCGCGGACCTTCCAGGAAATCGGCTTCGACTCGCTGACCGCGGTGGAACTGCGC
AACCGGATCAGCGCGGCAACCGGCGTACGGCTGCCAGCCACCGCCGTGTTCGACTATCCG
ACACCGCGAGCGCTCGCCGATCACCTGCTCGCCGAAGCCCTCGGGAAGGACATCGGCGCC
GCCGCCGCGACACCTGCCGGAGCGGCCCTCGTCGCCGACGATCCCATCGTCATCGTCGGG
ATGAGCTGCCGCTACCCCGGCGGGATCACCTCACCGGAAGCGCTGTGGGACCTGGTGCGC
TCGGGCGGCGACGCGATATCCGCCTTGCCCACCGACCGAGGATGGGACCTGGACGGTCTC
TACGACCCGGATCCGGACCGCCCCGGTAGGTCGTACGCCCGCAGCGGTGGATTCGTCTAC
GACGCGGCCGAGTTCGACGCCGCCTTCTTCGGGATCTCGCCGCGCGAGGCCGCCGCCATG
GACCCGCAGCAGCGGCTGCTGCTGGAAGCCTCATGGGAGGCGTTCGAGCGTGCGGGCATC
CCCGCCACCTCCGTAAAGGGCGAGCGGATCGGCGTGTTCACCGGGGTGATGCACCACGAT
TACCTCACCCGCCTGTCGATCACACCGGACGGTGTCGAGGGCTATCTGGGCACGGGCGCG
GCGGCCGGCGTCGCCTCGGGCCGCGTGGCGTACACCTTCGGGCTCGAGGGCCCGGCGGTC
ACGGTGGACACGGCCTGCTCGTCGTCGCTGGTGGCCCTGCACCTCGCCATACAGGCGCTG
CGCCTCGGCGAGTGCTCGCTCGCGCTGGCCGGTGGTGTGACGGTGATGTCCACCCCCACC
GTCTTCGTGGAGTTCTCCCGTCAGCGTGGGCTCGCGTCGGACGGCAAGTGCAAGGCGTTC
GCGGGAGCGGCGGACGGCACCGGCTTCGCCGAAGGCATCGGCATGCTGCTGGTCGAACGG
CTCTCGGACGCACGGCGCAATGGACACCCCGTCCTGGCGGTGGTGCGGGGTAGTGCGGTG
AATCAGGATGGTGCGTCGAATGGTTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTG
ATTCGTCAGGCGTTGGCGAGTGCGGGGTTGTCGGCGGTGGATGTGGATGCGGTGGAGGCG
CATGGTACGGGTACGACGCTGGGTGATCCGATCGAGGCGCAGGCGTTGTTGGCCACGTAT
GGTCAGGGTCGGGATGCGGACCGGCCGTTGTTGCTGGGGTCGATCAAGTCGAATATCGGG
CACACTCAGGCTGCCGCCGGTGTCGCCGGTGTGATCAAGATGGTCATGGCCATGGGCCAT
GGTGTGCTGCCGCAGACTCTGCATATCGATGAGCCCACTCCACACGTGGACTGGTCCACC
GGCGCGGTGCGACTCCTGGGTGAGCACACGGAGTGGCCAGAGGCCGGGCGGCCCCGCCGG
GCCGGTGTGTCGTCGTTCGGCATCAGCGGAACGAACGCGCACCTGATCCTTGAGCAGGCC
CCGCTGCCGACGACAGCGGAGCGACCCGACGACGCCGAGCCCGGCGATGCGAAGTCCGGT
GACGTACGGCCCGGTGACGTACGGCCCGATGATGTGCGGCCCCGTGCGGCCGGGCCCGGT
GCCGTGGTGCCCTGGATCCTCTCGGGACGCGACCGGCGCGCCCTGCGCGCACAGGCGGAA
CGACTGCGCGCACACGTGGCGAGCCACCCGGACCTGAGTGTGGCGGACATCGGTTTCTCG
CTGCTGACCAGCCGCGCGGTGCTGGAACACCGTGCGGTGGTGCTCGGCGGCGACCACGCC
GAACTTTCGGCCGGGCTGACGGCCCTGGCACAGGACGAACCCGCACCGGGCGTGGTGGAG
GCCCTGGACGCGGCCGAACCGGGACGCAAGGTGGTGTTCGTCTTCCCCGGTCAGGGGTCA
CAGTGGGCCGGGATGGCGCTGGAACTGCTGGAGTCCGCACCCGTGTTCGCGCGGCGGATG
GGCGAGTGCGCCGAAGCGCTGGCTCCGCTGGTGGAGTGGTCGCTGCCGGACGTGTTGGCG
GATGAGCGAGCGCTGGGCCGTGTCGATGTGGTGCAGCCGGTGCTGTGGGCGGTGATGGTG
TCACTGGCCGAGCTGTGGCGTTCGTACGGTGTGGCGCCATCGGCGGTGGTGGGCCACTCG
CAGGGTGAGATCGCGGCGGCGTGTGTCGCGGGCGGCCTGTCCCTGGCGGACGGGGCACGG
GTGGTCGTACTGCGCGGCAAGGCGCTGCTCGCCTTGTCGGGCCGGGGCGGAATGGTGTCC
GTTCCGGTGCCTGCCGACCGGCTGCGGGACCGGCCCGGGGTCTCCATCGCGGCGGTGAAC
GGCCCGTCCTCGACGGTGGTGTCCGGCGGCGACGAGGCGCTGGACGCGGTGCTGGTGGAG
TTCCCGGCGGCCAAGCGCATCCCGGTGGACTACGCCTCCCACTCGCCCCAGATCGACGGC
ATCCGGGACGAACTGCTGAAGGCCCTGGCGCCGATCGAGCCGCGCACCGCGGCGATCCCC
TTCCACTCCACGGTGACCGGACGGCCCATCGACACCGCCGAGCTGGACGCGGACTACTGG
TATCGCAACCTGCGCGAGACCGTTGAGCTCGAGCGGGTCACCCGTGCGGCGGTCGAGGAC
GGCCATCACACCTTCATCGAGATCAGCCCCCATCCGGTGCTGACCACGGGCCTGCGCGAA
ACGCTCGATGACGCGGACGCGCACGGCGGCCTCGTACTGGCCTCACTGCGCCGGGACGAC
GGTGGCCTCACCCGTTTCCGCACCGCCTTGGCCGAGGCGTACGCATACGGTGTCGAGGTC
GACTGGCTGTCGGTGTTCCCAGGCGCCCGGCGGGTGGAGCTGCCGACGTACGCCTTCCAG
CGCGAACGCTACTGGCTGGACGCCCCCACCGCCGAGGCTCCCACCAGCGCGATCGACGCG
GAATTCTGGGCCGCCGTCGAGCGCGAGGACCTCGAGTCGCTCGCCGCGACACTGCGCGTC
GACGGGCAGCCGCTGCGCGAAGTGCTGCCCGCCCTGTCCCAGTGGCGGCGCGAACGCCGT
GATGTCTCCACCATCGACTCATGGCGATACAAGATCCGGTGGAAGCCGCTCACCCCGCCC
GCCACTTGCCCGACCGGCACGTGGCTGGTCGTGGTCTCCCACGCCGAGGCCGAGCACGAG
TGGGTCGCGGGCGTGACCGGTGCGCTGACCCGTCACGGTGCCGAGCCGCTCGTGGTCGTT
CTCGGCGAGCCCGAACTGGACCGTGCCGCGCTGGCCGCCCGGCTGGGCGCGGCGCTGGCC
GACACCCCCAGGGTCAGCGGTGTGGTGTCGCTGACCGCGTTGGACGAAAGCCCGCACCCC
GCGTATCCCTCGGTCCCCCAGGGATACGCGATGACGCTGTTGCTCTCGCAGGCGCTCGGG
GACGCCGGAGTGGAAGCGCCGCTGTGGTGCCTCACCCAGCGTGGCGTCTCGCTCGGCGAT
GGCGGAGGCAACCGGGGAGGCGCTGGCGGACGCGGTGACGAAGGCAACGGCAGCGGTAAT
GGGAACAGCACTGGTAGTGGCAGCGGCAATGGTCCCGGCGAGGGCGATGGTGACCGTGAT
GTTGCCGTCAGCCGGAAGCAGGCCCTGACCTGGGGTCTCGGCAAGGTGATCGCCCTGGAA
CAGCCGCTGCGCTGGGGCGGTTTGATCGACCTGCCGGAGGGTGTGGCCCCGTATGCCCAG
GACTACCTGGTCGGTGTGCTGGCCGGCACCTCGGACGAGGATCAGGTGGCGATCCGCCCG
ACGGGGCTCTTCGGCCGGAGGCTGGCCCACGCACCGGCCCCCGAGCGAGGCGGGGCCTGG
CAACCCCGTGGCACCGTACTGGTCACCGGTGGCACCGGAGCGCTGGGCGGCCATGTCGCC
CGGTGGCTGGCCGCCCAGGGCGCTGAACACGTGGTACTGACCAGCCGCCGGGGCATGGCC
GCGCCCGGCGCCGAACGGCTGGCCGGGGAGCTGGAGGCGCTCGGCGCCCGGGTGACGGTG
GCGGCGTGCGACGTCGGTGACCGGGACGCCCTGGCCGCATTGCTGACCGAGGTCGGCCCG
CTGACCGCCGTGGTGCACACCGCGGCGGTCCTCGACGACGCCACCCTGAACTCGCTCACC
ACCGAGCAGCTGCAACGAGTGCTGCGCGTGAAGACCGATGGCGCGGTGCATCTGCACGAA
CTGACACGCGACATGGAGTTGTCCGCGTTCGTGCTCTTCTCCTCGCTTTCCGGCACTCTC
GGCGCACCCGGTCAGGGCAACTACGCACCCGGCCACGTCTTCGTGGACACGTTGGCCGAG
CAACGGCGGGCCGAGGGCCTGGTGGCCACCTCCATCGCCTGGGGTCTGTGGGCCGGTGAC
GGCATGGGCGAGGGTGGTGTAGGCGAAGTGGCCCGCCGCCATGGCGTACCGGAGATGGCA
CCGGAGATGGCGGTCGCCGCCATGGCTCGCGCCGTCGAGCAGGATGACACCGTCGTCACG
GTCGCCGAGATCGACTGGGACCGGCACTATGTCGCGTTCACCGCGACCCGCCCCAGCCCG
CTGCTGTCCGACCTCCCCGAGGTACGTGCGCTGATCGACGCCGGAGTCGGCCAGGAGAGC
GCCGAACCGGGCCACGAGCGCTCGGAGTTCGCGGAGCGACTCGCCGGGATGGCCGACGCC
GACCGGAACCGCGCGTTGCTGGATCTGGTACGGCGCCATGTCGCGGTCGTACTCGGACAC
ACCGGCCCGGACGCGATCGACCCCGGTCGCGCCTTCCACGAGATCGGCTTCGACTCGGTC
ACCGCGGTCGAATTGCGCAACCGGCTCAACCGGGCCACCGGCCTACGGCTGCCGGCCACC
GTGACGTTCGACCAACCCACCCCGCTGGCGATGGCGCGGTACCTCCGTGGCGAACTGCTG
CACGACGGCCAGGACCGATCGGCCCCGGCCCGCCCGGTCCGCACGACCGGCGCGGTGGAC
GACGAGCCCATCGCGATCGTGGGCATGAGCTGCCGCTTCCCCGGGGACGTCGCATCCCCC
GAGGACCTGTGGCGCCTGCTCGCCGACGGTTCCGACGCCATCGGCGAGTTCCCCGAGAAC
CGGGGCTGGGACACCGCGCACCTCTTCCACCCGGACCCCGACCACCGGGGCACCTCCTCC
ACCCGAGCGGCCGCGTTCGTCTCCGGGGCCGGTGAGTTCGACGCCGGATTCTTCGGAATC
TCCCCGCGGGAGGCGGTGGCGATGGACCCGCAGCAGCGGCTGCTGCTCGAAGTGTCATGG
GAGGCGCTGGAGCGGGCCGGGATCGACCCCTCGACCCTGCGGGGCAGCGAGACCGGCGTG
TTCACGGGGACGAACGGCCAGGACTACGCGTCGTTGCTGAAGGCGGACGAGACGGGTGAC
TTCGAGGGCCGGGTGGGCACCGGCAACTCGGCATCGGTCATGTCCGGCCGGATCTCCTAC
GTCCTCGGCCTCGAAGGCCCCGCGCTGACCGTGGACACGGCGTGCTCGTCGTCACTGGTG
GCATTGCACCTGGCGGTGCGGGCCCTGCGGTCGGGCGAGTGCTCACTGGCCCTGGCGGGC
GGCGCGAGCGTCATGACGACCACCGGCATCTTCGTGGAGTTCTCCCGTCAGCGGGCGTTG
GCGGCCGATGGCCGGTGCAAGGCGTTCGCGGCGGGCGCGGACGGCACCGGCTGGGGCGAG
GGCGTCGGCATGCTGGTGGTGGAGCGGTTGTCCGATGCTGAGCGGAACGGTCACCGGGTG
TTGGCGGTGGTGCGGGGTAGTGCGGTGAATCAGGATGGTGCGTCGAATGGTTTGACGGCG
CCGAATGGTCCGTCGCAGCAGCGGGTGATTCGTCAGGCGTTGGCGAGTGCGGGGTTGTCG
GCGGTGGATGTGGATGTGGTGGAGGCGCATGGTACGGGTACGACGCTGGGTGATCCGATC
GAGGCGCAGGCGTTGTTGGCCACGTATGGTCAGGGTCGGGATGTGGACCGGCCGTTGTTG
CTGGGGTCGATCAAGTCGAATATCGGGCACACTCAGGCCGCTGCCGGTGTCGCCGGTGTG
ATCAAGATGGTCATGGCCATGGGCCATGGTGTGCTGCCGCAGACTCTGCACATTGATGAG
CCCACTCCACACGTGGACTGGTCCACCGGCGCGGTGCGCCTCCTGGATGAGCAGACCGAT
TGGCCGGAGACCGCACGGCCCCGCCGCGCCGGAGTGTCCGCCTTCGGGGTGAGCGGCACC
AACGCCCATGTGATTCTGGAGCAGGCCCCCGCGCCGACCGCCGAGCCCGAGCTCTCGCCG
GAACGCGATGAAACGAGGGCCGTGCCGTGGGTGGTCACGGGTGCGAGCGAAGCCGGTGTC
CGCGCACAAGCCGCACGCCTCATGGCCTTTGTCGACGACCGGCCGGAACTCCGCCCGGTG
GATATCGGTTGGTCGCTGGTCTCGACCCGCGCGGCTCTGCCTCATCGTGCGGTGGTGGTG
GGCGGGGATCGCGATGAACTCGTTCGTGAGCTGGAGGCCGTGGCCGGTGGCAGCGCCGCG
ATCGGCGAGGCCCGCACGCATTCCGGGGTGGTGTTTGTCTTCCCTGGTCAGGGGTCGCAG
TGGGTGGGGATGGCGTTGGAGTTGGTGGAGTCGTCTTCGGTGTTTGCGGGGCGGTTGGGT
GAGTGTGCGGATGTGTTGGCGCCGTTGGTGGAGTGGTCGTTGTGGGATGTGTTGGGTGAT
GAGGTGGCGCTCAGTCGGGTGGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCG
TTGGCGGAGTTGTGGCGTTCGTTTGGTGTGGTGCCGTCGGTGGTGGTGGGGCATTCGCAG
GGTGAGATTGCGGCGGCGTGTGTGGCGGGTGGTCTTTCTCTGGAGGATGGGGCGCGGGTG
GTGGCGTTGCGGAGCAGGGCGTTGCTGGCTCTGTCGGGTCGGGGCGGGATGGTGTCGGTT
CCAGTGCCTGCCGACCGGCTTCGTGACCGTCCGGGGTTGTCGGTGGCGGCGGTGAATGGT
CCGGTGTCGACGGTGGTGTCCGGGTCGGTTGAGGCGCTGGATGCGGTGTTGGAGGAGTTC
CCGGAGGCCAAGCGGATCCCTGTGGAATATGCCTCGCATTCGGTGCAGGTGGAGGAGATC
CGGGAGGGGCTGGCGGAGGCGTTGGCGTCGGTCCGGCCGCGTACGGGTGAGGTGCCGTTC
TATTCGACGGTGACGGGGCGGCTGATGGATACCGTCGAGTTGGATGCGGAGTACTGGTAT
CGGAACTTGCGTGAGACGGTGGAGTTCCGGTCCGCGGTCGAGGGGCTGCTGGAGCTTGGT
CATACGGTGTTTGTCGAGGCCAGTCCGCATCCGGTGCTGACCGTCGGCATCCAGGACACC
GCCGACGCCACCGACACCACCCACACCGATATCCTCGTCACCGGGTCACTGCGCCGCGAC
GATGGCGGCCTGGTCCGCTTCCTCAGCACCGTCGGCCGACTGTTCACCGCGGGTGTGCCC
GTCGAGTGGCAGCCGCTGTTCGCCGCGGCCGGGGCGCGAAGGGTCGATCTCCCGACCTAT
GCGTTCCAGCATGAGTGGTTCTGGCTGGATCCGGTGCGCGGCGCGAGCGATGTGGGCGGC
GCGGGCCTTGCCGGTCTCGCTCACCCCTTGGTGAGCGCGGTGTTGCCCCTGCCCGAATCC
GACGGCTGTGTGCTGACCGGCTCGCTCTCCTCGGCCACCCATCCTTGGCTGCGCGATCAC
GCCGTGCTGGACAAGGTGTTGCTGCCAGGTACCGGGTTCGTCGAACTGGCTCTTCAGGCC
GGGCTGCACCTGGGCTGCCGTACGCTGGATGAGCTGACCCTGCAAGCGCCACTCGTACTG
CCCGCGCACGGCGACGTACAGATCCAGGTGGCGGTCGGCGGACCGGACGACAGCGGCCGG
CGGCCGGTCACGGTGTACTCCAGGCCGGGCCAGGACCGGACCTGGGTACGGCACGCCACC
GGCAGCGTCAGCCCCGGCGGTGAAACGGCCACCGTGGATCGGACGGTATGGCCCCCAGTC
GACGCCACACCGGTCGACCTCACCGGTGTCTACGCTGAGATGAACACCCGCGGTTACGCG
TATGGGCCCGTTTTCCAAGGGCTGCGGGCCGCATGGCGGCGTGGCGACGAGGTGTTCGCC
GAGGTGGTCCTGTCCGAGACGGCCGAGAGCGACGCGGGTCGTTGCGCCGTTCACCCCGCC
TTGCTCGACGCCGCACTGCACGGCGCCGGACTGGGCACGTTCGTGACCGAACCGGGCCGA
CCGCACCTTCCGTTCGCCTGGACCGGTGTCAGCCTGCACGCCGTCGGTGCCACCACTTTG
CGGGTCGTCCTGTCGCCCGCCGGGCCGGACGCCATCTCGCTCCTGGCGATGGACGGTACG
GGAGCGCCGGTGCTGACGGCGGACTCTCTGGCGCTGCGCCCGGTGTCCGGGGGCACGCGG
GGCGGCGCACACAACGACTCGCTGTTCCGAGTGGACTGGACCGAGCTCGCCTTGGCCGCC
TCGGACACCTCGGATGAAGTGGCCTTCCCCGTCGTCGAGTCCTTGGCCCAGCTGACCGGG
CCGGGGGCACCCCAGCCCGTACACGGGGCCGTGGTGTTCCGGCCTTTCGCCACAGAGGCT
TCCGCCACAGAGGCTCCTGCCACAGAGGCTTCCGTCGCAGGGGCCACAGATGCCACAGGG
GCCGCGGATACCACCGAGGAGAACCCGGAGGACGTCTACGCGCTCACCAGCCGTGTCCTC
GAGGTCGCGCAGGCGTGGCTGGCGGACGACCGGTTCGGGGACGCCCGCCTCGTCGTGGTG
ACGCGGGGCGCGGTCGCGACCAGGCCCGGTGAAGACCCGGAGAGCCTTGCCGCAGCCGCG
GTTTGGGGCCTCATCCGCACCGCGCAGACCGAGAACCCCGGCCGCTTTGTGCTCGTGGAC
ACGGTGGACGAGGATCCGTCGGTGTCGTCGGTGTCGTCGGTGTCGTCCACGTCATCCGTG
GTGTCCGCCTTGCCCGCGGTGCTCGCCACCGATGAGCCGCAGGTGGCGATCCGGGCGGGG
AAGGCGCTGGTGCCCAGGCTGGTACGGGCCGCCTCGTCGGCGTTGCCGGTACCGGCGGAG
ACGGACACCTGGCGGCTGGAGGCCGACGGCCAGGGCACTCTGGAGAACCTGGTCCTCGCG
CCCCACGCGGAGGCGTCCAGGCCACTTGCCACACATGAGATCCGGGTGGCCGTGCGTGCC
GCCGGGGTCAACTTCCGTGATGTACTGCTCGCTTTGGGGATGTACCCGGACAAGGCCGGT
CTGCTGGGCAGCGAAGCCGCCGGGACGGTTCTGGAGATCGGCTCCGGGGTAGCGGGAGTG
GCACCGGGAGACCGGGTGATGGGCCTGTTCTCCGGCGCCTTCGGGCCGGTGGCCATCACC
GATCACCGACTGGTGGCCCCGATCCCTGCGGGGTGGTCCTTCCCGCAGGCCGCCGCCACC
CCGATCGCCTTCCTCACGGCGATGTACGCCTTGATCGACCTGGCCGATGTGCGGAGCGGC
GAATCGGTGCTGGTGCACGCCGCGGCCGGTGGCGTCGGGATGGCGGCAGTGCAGGTGGCG
CGCTGGCTGGGCGCCGAGGTGTTCGCAACCGCGAGCCCGGCCAAGTGGGATGCGGTACGC
GCATGCGGGGTCGCCCAGCAGCGGATCGCCTCCTCCCGCTCGACGGAATTCGCGGACCGC
CTCCGCTCGGACGCACCGGGCGGCGTGGATGTCGTACTCAACTCGCTGACCGGCGAACTC
CTCAACGCGTCGCTCGGACTGCTGCGTCCCGGTGGACGCCTGATCGAGATGGGCAGGACC
GACCTCCGGGACGCCGAGGAGGTGATGGCGCGCCACGGTGTGTCGTACCGGGCCTTCGAA
CTGCTCGACGCCGGTCCCGACCGTATCGGCCGACTGCTCACCGAACTGCTCTCACTGTTC
CGGCAGGGCGTGTTCACCCCGCTGCCACTGCGCGTCCAGGACGTACGCCAGGCGAGCGAT
GCCTTCCGCCACCTCTCCCAGGCGCGCCACATCGGCAAGCTGGCCCTCACCATCCCGCGA
CCGCTCTCCGGCGGCACCGCACTGATCACCGGGGGCACCGGGACACTGGGCGGTCTGGTG
GCGCGCCATCTGGTGCGGGAACACGGAGTGACGGAGCTGGTGCTGGTCGGCCGCCGTGGT
GACACCGCTCCGGGGGCGGCGGAGCTGCTCACCGAGCTGGAGGCCGCCGGAGCCCGGGTG
CGGGTGGTCGCATGCGATGTGTCGGACCGGGAGGCGACCGCCGCACTCGTCGCCTCGCTG
CCGAACCTGCGGAGCGTGGTGCACACGGCTGGTGTCCTCGACGACGCCGTGATCGGGTCG
CTCACCCCGGAGCGGCTGCGGACGGTACTGCGCCCCAAGGCGGACGCCGCATGGCATCTG
CATGAACTGACCCGGGACCGGGACCTGGCCGAGTTCGTGTTGTTCTCCTCGGCGGCCGGA
GTACTCGGTGGCCCAGGACAGGGCAACTACGCGGCGGCCAACGCCTTCCTCGACGCGCTG
GCCGCGCGCCGCCGGGCACAGGGGCTGCCCGCGACCTCGCTGGCCTGGGGCTTCTGGGAG
CAGCGCAGCGGACTGACCGAACATCTGACCACCGACCGGCTCGCCCGGTCCGGCGTGCTG
CCGCTGTCCACCGACGAGGGGCTGGCCCTCTTCGACGCCGCCCGCGCGACCGGCGACACC
CTGCTGGTGCCGATGCGTTACGAACCGTCCGCACCGGGCCCCGAGCCGGTGCCCGCCCTC
CTGCGTGGCCTCGTACGCGCTCCGCTCGCCCGAGCCCTTCCAGGCCCGGCCGATGGTGTC
GGCAACGGTGTGACCGAGGGCCTCACCGGGCTGGCGGTGGACGAACGCCTCGGTGTCCTG
CTCGACCTGGTCCGCCGGGAGGCGGCGGCCGTGCTCGGCCACGGCGGTCCGCAATCGGTG
ACACCGCGGCGGCCGTTCAAGGAACTCGGCTTCGACTCGCTCTCCGCGGTGGAACTGCGC
AACCGGCTGCGCACGGCGACCGGCCGACGGCTGGAGGCCACCCTGATCTTCGACCACCCC
ACTCCGGCCGCGCTCGCCCGCCACCTCGACGCCGAGCTGTTCGGCGCCACCGATGTGGCG
GCGCCCGTACCGGCACCGACGGTCGCGCACCCGGCCGATGAACGGATCGCCATCGTCGGC
ATGAGCTGCCGGCTCCCCGCCGGAGTGGACTCCCCGGAGGCGCTGTGGACGTTGCTGATG
AGCGGCACGGACGCGATATCGGAGCTGCCCACCGACCGCGGCTGGAGTCTCGACGCGCTC
TACGACCAGGACCCGAGCCGGCCCGGCACGACATACGCCAAGACCGGTGGCTTCCTGAAG
AACGCGGCGGACTTCGACGCGGGATTCTTCACCATCTCCCCGCGAGAGGCGCTGGCCGCG
GATCCCCAGCAACGGCTGTGGCTCGAGGCGTGCTGGGAAGCCTTCGAACGCGCCGGTATC
GATCCCCTCGCCCTGAAGGGCACCCGCACCGGGGTGTTCGCGGGTGCCGCTTCGACAACG
TACGGCGCGGGCCAGGCCGCCGCTCCGGACGGCTCCGAGGGGTATCTGCTCACCGGGAAC
TCCACCTCCGTGATCTCCGGCCGCGTGGCCTACACCCTCGGCCTCGAAGGCCCCGCCGTC
ACCGTGGACACCGCATGCTCGTCCTCGCTGGTCAGCGTGCACTGGGCGTGTGAGTCCCTG
CGCAGGGGCGAAAGCACACTGGCGCTGGCGGGCGGCGTGGCGGTGATGACGACACCGGAC
CTGCTGGTCGAATTCTCCCGCCAGCGCGGACTCGCACCGGACGGGCGGTGCAAGTCGTTC
GCCGCCGCCGCTGATGGCACCGGGTTCGCCGAAGGCGCCGGAGTGCTCGTCCTGGAACGG
CTCTCCGACGCCGAGCGGAACGGCCACCAGGTGCTGGCGGTGATCCGTGGCTCCGCCGTC
AACCAGGATGGCGCTTCCAACGGGCTGACGGCGCCGAACGGTCCCTCGCAGCAGCGGGTG
ATCCGGCAGGCGCTGGCGAACGCCGGGCTGGCCTCCCAGGAAGTCGACGCGGTCGAGGCG
CACGGTACGGGTACGACGCTGGGTGATCCGATCGAGGCGCAGGCCCTGCTGGCCACCTAC
GGCCAGGACCGGGATCCGGATCGGCCACTGCTGCTGGGCTCAGTGAAGTCCAACATCGGA
CACACCCAGGCGGCCGCGGGCGCCGCCGGACTCATCAAGATGGTTCTGGCGCTGCGCAAC
GGCGTACTGCCACGCACCCTGCACGTCGACGAGCCCTCCCCGCACGTCGACTGGTCCGCC
GGGGCCATGGAACTGTTGACCGAGCAGACCACGTGGCCCGACCGGGACCGCCCGCGCCGG
GCCGGAGTGTCCGCGTTCGGGGTGAGTGGCACCAACGCCCATGTGATCCTCGAACAGGCC
CCGAAGCCGGACGAGAACGGCGAGCCGGACACTGGCCGGTCGGGGTTGCCCGCAGTGCCC
TGGGTGCTGTCGGGTGCGGGAGCGGCCGGGCTGCGGGCCCAGGCCCAGCGGCTGGCCTCC
TTCGTACGGGAGAACCCCGAGCTCGACCCCGTGGACGTGGGCTGGTCCCTGGTCGCGACC
CGCGCTGCCCTGTCGCACCGGGCGGTGGTCGTGGGCGCGGACCGCACGGAACTGCTGCGC
GAGCTGGACGCGGTGCAATCCGTGGGCGCCGCCGAGGCGGGGCGCGACGTGGTGTTTGTC
TTCCCTGGTCAGGGGTCGCAGTGGGTGGGGATGGCGTTGGAGTTGGTGGAGTCGTCTTCG
GTGTTTGCGGGGCGGTTGGGTGAGTGTGCGGATGTGTTGGCGCCGTTGGTGGAGTGGTCG
TTGTGGGATGTGTTGGGTGATGAGGTGGCGCTCAGTCGGGTGGATGTGGTGCAGCCGGTG
TTGTGGGCGGTGATGGTGTCGTTGGCGGAGTTGTGGCGTTCGTTTGGTGTGGTGCCGTCG
GTGGTGGTGGGGCATTCGCAGGGTGAGATTGCGGCGGCGTGTGTGGCGGGTGGTCTTTCT
CTGGAGGATGGTGCCCGGGTGGTGGCCTTGCGGAGCAAGGCGTTGCTGGCTCTGTCGGGT
CGGGGTGGGATGGTGTCGGTTCCGGTGTCTGCCGACCAGCTTCGCGATCGTCCGGGGTTG
TCGGTGGCGGCGGTGAATGGTCCGGTGTCGTCGGTGGTGTCCGGGCCGGTTGAGGTGCTG
GATGCGGTGTTGGAGGAGTTCCCGGAGGCCAAGCGGATCCCTGTGGACTACGCCTCGCAT
TCCTCGCAGGTGGAGGAGATCCGGGGGGAGCTGGCGGAGGCGTTGGTGTCGGTCCGGCCG
CGTACGGGTGAGGTGCCGTTTTATTCGACGGTGACCGGTCGGCTCATGGACACCGTCGAG
TTGGATGGGGAGTACTGGTATCGGAACCTGCGTGAGACGGTGGAGTTCCAGAGCACCGTC
GAACACCTTATGCGCGAGGGCCATACGGTGTTTGTCGAGGCCAGTCCGCATCCGGTGCTG
ACTGTCGGCATCCAGGACACCGCCGACGCCACCGTCACCGACATCGTGATCACCGGTTCG
CTCCGCCGGGACGAGGGAGGCGTCCGGCGGTTCCTGACGTCACTGGCCGAGGTGTCCGTC
CGTGGTGTCGAGGTCAACTGGTGGACGGCCTTCGACGGCGCCGGCGCTCGGCGAGTCGAC
TTGCCCACTTACGCGTTCCAGCGTGAGCGGTTCTGGTTGGCGCCATCGACGGGCACGGGC
GACGCGTACGGGCTGGGCCTGGGCGCCGTTGACCATCCGTTGCTGGGCGCGGCGGTGCCC
CTCCCGGACGCGGATGGCTGTGTGCTGACCGGTGCGCTGTCGCTGGCCGGGCAGCCATGG
CTGGCGGACCACTCCGTCCTCGGCATGGTCCTTCTGCCGGGCACCGCGTTCGTGGAGCTC
GCGTTGCAGGCGGGGGCACGGTTCGGCTGCGACACGCTGGAAGAGCTGACGCTGCATGAG
CCGCTCGTCCTGCCCGAGCAGGAGACCGTGCAGCTCCAGGTGTCGGTCGGCGGCCCGGAT
GACCTCGGTAGCCGCCCCTTCACGGTGTTCTCGCGCCGTGAGGGCGACTGGACACGCCAC
GCCGGAGGCACCCTGTGCGTGGGCGAGCATGGCGATCCGCCTGCGAATCCGTCGGTGTGG
CCACCGGCCGATGCCCGGCCGGTGGATGTCGCCGAGCTGCACATGACGATGGCCGAGCGG
GGCTATCAGTACGGACCCGCCTTCCAGGGCCTGCGGAAGGCTTGGATCCGCGACAGCGAG
GTGTTCCTCGACGTCGCGTTGCCCGAGTTGGTGAGGGGCGACGCCGCCCGCTGCGGAGTG
CATCCCGCGTTGCTGGACGCGGCCCTGCAAGGCATCGGCCTTGGCGCCTTCGTCAGCGAA
CCGGGACGGGCCCATCTCCCCTTCTCCTGGAGCGGGGTGACCCTGCACGCGGTGGGCGCC
ACCACCGTGCGGGTGACGCTCAGCCCGGCCGGACCGGACGCGGTGGCCATCCGGATGACG
GACACCATCGGGGCGCCCGTGCTGTCGATCGACGTCTTGGCGATGCGCCCGCTCGCGGAG
CAGCGGCTGCTTGAGGCGGGCGGCCCCCGTGGCGACGCACTGTTCCGGCTGGACTGGACG
GAGCTTCCCGTCCCCACGGGGGCCACCGGCCCGCGGGCCCTGTCCTGGGGCCTGCTGGGC
GGCCACGACGAGCCCCGACTCACGGCCGCGCTGACCGCGGTCGGTGTGTCACCACAACGC
CACCGGGACCTCGCCTCCATCGACCAGGTGCCCGATGTATTGGTCCTGCCGTGTCTGCCC
GAGGCGGATGACGGCCCGGCCCCGGAAGCCACCTCGTCCACTCTCGGCCGAGTGCTGGAA
GTGGTGCGGGAGTGGCTCGGGGACGCGCGGTACACCGATACCCGCCTGGTGGTGCTCACC
CGCCGTGCGGTGGCCACATCCACCGGTGACGACGTGGAGGATCTGGCGGCGGCCGCCGTA
CGGGGGCTCCTGCGCACCGCACAGCAGGAGAACCCCGACCGGCTCGTCGTGATCGACCAT
GACGACTCGGACCTTGGGGTACTGCCCGCGGTGCTCGCGACAGGGGAACCCGAAGCGGCC
ATCCGGGCGGGTACGGTGCTGGTGCCCAGACTGGTCAAGGCGGCCGTACCGGATGGGAAA
ACCCCTGCCTGGGACACGGGCACCGTACTGATCACCGGCGGGACGGGGACACTCGGCGGC
CTGGTCGCCCGCCATCTGGTGACCACCCATGGCGCGCGTGACCTGGTGCTGGCCAGCCGC
GGAGGTGACACCGCGCCCGGTGCCGTGGAACTGGCCACCGAGCTGGAGGCGCTCGGCGCC
AGTATCCGCGTCGCCGCCTGCGATGTGGCCGATCGTGCCCAGCTGACCGCGCTGCTCGAC
ACCATTCCGGCGCTGCGCGCCGTCGTCCACACCGCCGGTGTGGTGGACGACGGTGTTATC
GGCTCGATGACCGCCGACCGCGTGGAGGCCGTCCTGCGGCCGAAAGCGAACGCGGCGTGG
CACCTGCACGAGCTGACCCGCCGACTGGACCTGGACGCGTTCGTACTGTTCTCCTCCGCC
ACCGGAGTGCTGGGCAGTGCGGGACAGGGCAACTACGCCGCGGCCAACGCCTTCCTCGAC
GCGCTGGCCGTGCACCGGCGGGCCCAGGGGCTCCCCGCGGTGTCGGTGGCATGGGGCCTG
TGGGAGCAGCGCAGTGGCCTGACCGCACATCTGTCGGAGCAGGACATGGCCCGTATGACC
CGCACGGGCGCCATTCCACTCTCCGACGAGCGCGGTCTCGAACTGTTCGACGCCGTGTGC
CGGAGTGGCGAAGCCACGCTCGTGGCCACCCCGTTGCACCTTCGTGCGGTGGCGGCCACC
GGTACGGTGCCGCCCGTGCTGAGCGCGCTGGCACCGGCCCCGCCGCGCCGGGCCACCGAG
GCCGGTGACGGTGGGGTGGCCCTGCGGCAGAGCCTGGCCGAGCTGTCGGGTGCGGAACAG
AGCCAGGCCGTACGGGAGTTGGTACGCGGCCAGGTCGCCGCGGTGCTGCGACACCCGGAC
GGGTCGGCGATCGACCCGGTGCGGACCTTCCAGGAAATCGGCTTCGACTCGTTGACCGCG
GTGGAGCTGCGCAACCGGCTGGGTGCCAGCACCGGAATCAGGCTGGCCGCGACCGCGATC
TTCGACTATCCGACACCTGCCACGCTGGCGGAGCATCTGCTCGCCGAGATCGTGCCGGAG
ACCGCCGACCCGGTCGCGGCCCGGCTCGGCGAGCTGGACAAGGTGGCCGCCATGATTTCG
GCGATGGGCGAGGACGACACCCTGCGCGAGCAGTTGTCCTCTCGGATGGAGACCATCGTT
GCGATGTGGGCCGACCTGCACCGTCCGGAGCGGTCGAGCAGGGTTGGGCGGGACCTCGAA
TCGGCCTCGCTCGACGACATGTTCGGAATCATCGACCAGGAACTCGATGGGTCATGA
[4] KS34..406
[4] AT556..876
[4] ethylmalonyl-CoA748..752
[4] DH921..1083
[4] KR1360..1540
[4] ACP1640..1710
[5] KS1734..2110
[5] AT2292..2600
[5] methylmalonyl-CoA2471..2475
[5] KR2944..3120
[5] ACP3226..3296
[6] KS3321..3699
[6] AT3851..4160
[6] methylmalonyl-CoA4030..4034
[6] DH4208..4368
[6] ER4712..5016
[6] KR5025..5202
[6] ACP5300..5370
[7] KS5393..5770
[7] AT5918..6225
[7] methylmalonyl-CoA6097..6101
[7] DH6272..6431
[7] KR6747..6924
[7] ACP7024..7094
[4] KS100..1218
[4] AT1666..2628
[4] ethylmalonyl-CoA2242..2256
[4] DH2761..3249
[4] KR4078..4620
[4] ACP4918..5130
[5] KS5200..6330
[5] AT6874..7800
[5] methylmalonyl-CoA7411..7425
[5] KR8830..9360
[5] ACP9676..9888
[6] KS9961..11097
[6] AT11551..12480
[6] methylmalonyl-CoA12088..12102
[6] DH12622..13104
[6] ER14134..15048
[6] KR15073..15606
[6] ACP15898..16110
[7] KS16177..17310
[7] AT17752..18675
[7] methylmalonyl-CoA18289..18303
[7] DH18814..19293
[7] KR20239..20772
[7] ACP21070..21282

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [547-679]  G3DSA:3.40.366.10 [748-864]  G3DSA:3.40.366.10 [2287-2412]  G3DSA:3.40.366.10 [2471-2589]  G3DSA:3.40.366.10 [3843-3971]  G3DSA:3.40.366.10 [4030-4149]  G3DSA:3.40.366.10 [5910-6038]  G3DSA:3.40.366.10 [6097-6214]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4840-4861]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1668-1683]  PS00012 [3254-3269]  PS00012 [5328-5343]  PS00012 [7052-7067]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1643-1709]  1.3e-13 PF00550 [3229-3295]  5.5e-10 PF00550 [5303-5369]  1.4e-12 PF00550 [7028-7093]  7.20000000000001e-10 PF00550
PF00550   PP-binding
 [1633-1750]  1.89999859865865e-28 SSF47336 [3219-3338]  3.80000697093586e-25 SSF47336 [5293-5410]  2.19999900980708e-29 SSF47336 [7016-7111]  2.19999900980708e-22 SSF47336
SSF47336   ACP_like
 [1640-1710]  PS50075 [3226-3296]  PS50075 [5300-5370]  PS50075 [7024-7094]  PS50075
PS50075   ACP_DOMAIN
 [1640-1712]  6.49999999999992e-92 G3DSA:1.10.1200.10 [3224-3299]  6.49999999999992e-92 G3DSA:1.10.1200.10 [5300-5373]  6.49999999999992e-92 G3DSA:1.10.1200.10 [7022-7097]  6.49999999999992e-92 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [4703-4849]  2.19999900980708e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4851-4941]  3.60000000000001e-15 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4732-4788]  6.00000000000001e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1360-1539]  9.60000000000003e-59 PF08659 [2944-3119]  1.2e-59 PF08659 [5025-5201]  2.99999999999998e-63 PF08659 [6747-6923]  3.09999999999998e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  8.90000000000015e-94 PF00109 [1734-1984]  4.09999999999995e-96 PF00109 [3321-3573]  2.30000000000004e-97 PF00109 [5393-5644]  5.50000000000008e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-406]  2.59999999999998e-42 PF02801 [1992-2110]  2.29999999999998e-47 PF02801 [3581-3699]  5.40000000000002e-48 PF02801 [5652-5770]  2.19999999999997e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [556-876]  1.29999999999998e-99 PF00698 [2292-2600]  1.79999999999997e-98 PF00698 [3851-4160]  2.79999999999994e-95 PF00698 [5918-6225]  3.30000000000002e-96 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  7.1e-10 PF08990
PF08990   Docking
 [4-34]  3.30000164480624e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [554-847]  1.20000117458134e-62 SSF52151 [2290-2569]  2.39999798157263e-67 SSF52151 [3849-4132]  1.69998802370953e-66 SSF52151 [5916-6191]  1.99999636034521e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [682-747]  3.0999994589937e-13 SSF55048 [2414-2470]  4.70000326671386e-11 SSF55048 [3973-4029]  1.59999889349252e-10 SSF55048 [6040-6096]  5.59999989417023e-10 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-294]  G3DSA:3.40.47.10 [296-460]  G3DSA:3.40.47.10 [1733-1995]  G3DSA:3.40.47.10 [1996-2161]  G3DSA:3.40.47.10 [3324-3585]  G3DSA:3.40.47.10 [3586-3751]  G3DSA:3.40.47.10 [5396-5656]  G3DSA:3.40.47.10 [5657-5823]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-404]  2.1000026783403e-101 SSF53901 [1726-2108]  1.90000694315261e-102 SSF53901 [3314-3697]  7.49999605851445e-103 SSF53901 [5386-5822]  4.80002938964645e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1361-1548]  G3DSA:3.40.50.720 [2945-3126]  G3DSA:3.40.50.720 [4848-4939]  1.3e-19 G3DSA:3.40.50.720 [5021-5208]  G3DSA:3.40.50.720 [6746-6960]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1897-1913]  PS00606 [3486-3502]  PS00606 [5557-5573]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [558-856]  6.59996953923913e-109 SM00827 [2294-2580]  8.29994113369276e-115 SM00827 [3853-4141]  1.09999184471405e-111 SM00827 [5920-6205]  6.19996040581186e-113 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1641-1713]  2.1000026783403e-35 SM00823 [3227-3299]  3.39999972437719e-35 SM00823 [5301-5373]  1.20000117458134e-36 SM00823 [7025-7097]  1.40000506907309e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [921-1083]  6.80004680300024e-70 SM00826 [4208-4368]  1e-82 SM00826 [6272-6431]  3.89999861795218e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-458]  SM00825 [1736-2162]  SM00825 [3324-3751]  SM00825 [5396-5822]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1360-1540]  3.1999989904635e-56 SM00822 [2944-3120]  7.30000590915205e-57 SM00822 [5025-5202]  3.59998852907783e-57 SM00822 [6747-6924]  2.69998997787809e-57 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4712-5016]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit