close all open/close all

CDS information : Merid_00040


close this sectionLocation

Organism
StrainDSM 4137
Entry nameMeridamycin
Contig
Start / Stop / Direction51,363 / 86,177 / + [in whole cluster]
51,363 / 86,177 / + [in contig]
Location51363..86177 [in whole cluster]
51363..86177 [in contig]
TypeCDS
Length34,815 bp (11,604 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MerC
Gene
Gene (GenBank)merC
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[17159202] Organization of the biosynthetic gene cluster in Streptomyces sp. DSM 4137 for the novel neuroprotectant polyketide meridamycin. (Microbiology. , 2006)
Related Reference
ACC
Q1WEK7
PmId
[16806745] Isolation and characterization of meridamycin biosynthetic gene cluster from Streptomyces sp. NRRL 30748. (Gene. , 2006)
ACC
Q1WEK6
PmId
[16806745] Isolation and characterization of meridamycin biosynthetic gene cluster from Streptomyces sp. NRRL 30748. (Gene. , 2006)

close this sectionPKS/NRPS Module

8 malonyl-CoA
9 malonyl-CoA
10 methylmalonyl-CoA
11 malonyl-CoA
12 malonyl-CoA
13 methylmalonyl-CoA
14 malonyl-CoA
KS50..426
AT572..842
KR1145..1321
ACP1415..1485
KS1508..1879
AT2023..2292
KR2595..2771
ACP2857..2927
KS2950..3319
AT3471..3780
KR4110..4286
ACP4392..4462
KS4485..4862
AT5007..5275
KR5581..5757
ACP5852..5922
KS5944..6320
AT6466..6718
KR7064..7237
ACP7330..7400
KS7421..7798
AT7993..8324
DH8369..8536
ER8875..9173
KR9183..9360
ACP9465..9535
KS9559..9933
AT10090..10406
dh10451..10597
kr10917..11072
ACP11133..11203

close this sectionSequence

selected fasta
>polyketide synthase [MerC]
MSSENVRPGIEGAGTRMSNDEKVLEYLKKLTADLRQTRQRLQDVEAKSREPIAIVGMSCR
FPGGVSSPEDLWRLTESAVDAVSGFPTDRGWDLDGLYDPDPDRAGRSYAREGAFIPDAGH
FDAGLFGISPREALAMDPQQRLLLEASWEALERAGIPTDSLKGSRTGVFAGLMSSDYVSR
LPEVPDELEGYVGIGSAASVASGRVSYTLGLEGPAVTVDTACSSSLVALHLAVQALRSGE
CSLALAGGVTVMATPGTFVQFSRQRGLAADGRCKAFAAGADGTGWGEGVGMLVVERLSDA
ERNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANARLSAVDVDAVEAHGTG
TALGDPIEAQALLATYGQDRDGDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGVLP
RTLHVDEPSPHVDWSAGAVELLLGQVAWPDVDRPRRAGVSAFGVSGTNAHVMLEQAPEVA
EGSRDEGVALPAVPWVVSGVGEAAVRAQVARLREFVVGDPGLDPVDVGWSLASARAGLSH
RAVVVGADRDELLGGLGSAVVGVPVVGGLGVLFAGQGSQRLGMGRGLYEAYPVFAAAWDE
VCAQLDRYLDRSVGEVAWGDDVELIGETAYTQAGLFALEVALYRLIASWGVRADYLLGHS
IGELASAYVAGVWSLEDAARVVAARGRLMQGLPSGGVMVAVAASEGEVLPLLADGVAVAA
VNAPESVVVSGDEDAVQAVVDVLVGRGVRTRRLRVSHAFHSARMDGMLAEFGEVLDGVEF
HAPSLPVVSNVSGVVAGEELCSPEYWVRHVRETVRFADGLATLRGLGVGSFLELGPDGTL
TALADGDGVSVLQPGRPEPTAVMAALGGLYVRGVEVDWGAVFPGARRVDLPTYAFQRERF
WLEPSPVQPTTSAVDAAFWDAVERGDAEILGVDAEQPLSAALPALASWRRARQEESVIDA
WRYRLTWAPVVGPSSQLSGLWLVVVEPDEEETDVVAALRGAGAEVRVVTVDELGAGPVAG
VVSLLSVEATVSLVRGLVAAGGDAPLWCVTRGAVCVVDGDVVDPYASAVWGLGRVIGLEH
PDRWGGLIDLPTAWDERTSDLLCSVLSGATGEDHTAIRGNEVLGCRLSRATTSGPGPSTA
WEASGTALITGGTGALGSHVARWLADTGVEEIVLTSRRGVDAPGARELVAELSATGVSTR
VVACDVADRNAVAELIGTIPDLRVVVHAAGVPSWGPLSALTAQDLQDGMRAKVAGAIHLD
ELTRDMSLDAFVLFSSVAGVWGSGSQSAYAAANAFLDGLAWRRRGVGLVATSVAWGMWGG
GGMAVGGEEFLVERGVSGMAPGLAVVALGRALCDGETALVVADVDWERFGARFTALRPSP
LLSELIPDAADSAAPLGEFAARLQTMSEGDRMRAAVELVRVSAAAVLGHQGPEAIDPGRT
FQEIGFDSLTAVELRNRIATATGIRPPATMIFDYPTPAALAEYLTVELLGSPQDSVPPIQ
VAAPDDGDPIVIVGMSCRFPGNVESPEDLWRLIDSDGDAITAFPTDRGWDLTSLYDTAAG
EPGTSYARVGGFVHGAGEFDAGFFGISPREALAMDPQQRLLLHAAWEAFERAGIPAASVR
GSRTGVFVGASPQGYGAAEASEGYFLTGSSGSVISGRVSYTLGLEGPAVTVDTACSSSLV
ALHLAVQALRSGECSLALAGGVTVMATPTAFVEFSRQRGLAADGRCKSFAAGADGTGWSE
GVGLLLVERLSDAERNGHPVLAVVSGSAVNQDGASNGLTAPNGPSQQRVIRQALASAGLS
AVDVDAVEAHGTGTALGDPIEAQALLATYGQGRDVDRPLWLGSVKSNIGHTQAAAGVAGV
IKMVMAMRHGVLPRTLHVDEPSPHVDWSSGAVELLRERLLGPEMNRPRRAGVSSFGVSGT
NAHVVLEQAPGVVKGSRGEGVALPAVPWVVSGVGEAPSGPVNHSGVVDRNADLDPVDVGW
SLVATRSVLSHRAVVVGADREELLGGLGSVVVGVPVVGGLGVLFAGQGSQRLGMGRGLYE
AYPVFAAAWDEVCAQLDRYLDRSVGEVVWGDDAELIGETAYTQAGLFALEVALFALVSSW
GVRADYLLGHSIGELAAAYVAGVWSLEDAARVVAARGRLMQGLPSGGVMVAVAASEGEVL
PLLADGVAVAAVNGPESVVLSGDEGAVQAVVDVLVGRGVRTRRLRVSHAFHSARMDGMLA
EFGEVLSGVEFHAPSVPVVSNVTGVVAGEELCSAEYWVRHVRETVRFADGLATLRELGVG
SFLELGPDGTLAALTDGDGLPVLRRDRPEPLSVMAALGGLYVRGVEVDWDAVFPGARRVD
LPTYAFQRERFWLEPAAGEPSTSAVDAAFWAAVERGDVGSFGIDTEQTLSTALPALSSWR
RRHQERSLVESWRYRLDWSPIGAVSELPTLRGTWLVVGDTGDEVAAVLRAAGADARAVTT
AELGEVAAAGVVSLLPVEATVSLVQALGTAGIDAPLWCVTRGAVSVVDGDVVDPVQSGVW
GLGRVIGLEYPDRWGGLIDVPGVVDEEVGVWLCRVLGGGTGEDQVAVRGGGAWGARLVRV
VGSGLGGSVVWRGGGSALVTGGTGALGGHVARWLAGAGVENIVLVSRRGLAAPGVLGLVA
ELEGLGAVVRVVGCDVGDRDQVVGLLEGIVDLRVVVHAAGVLDDGVLESLSAGRVGEVWR
VKVGGALYLDELTRGRDLDAFVLFSSAAGTVGSAGQGSYAAANAALDGLAWRRRAEGLVA
TSVAWGAWADSGMGAGHTRTMAPRLALAALQRALDDDETALMIADIDWEQFGSRFGAVRP
SPLVGELLGGAARSTPAVGEFSDRLRSLPPAERERTVLEIVRGQVAVVLGHATPAAIDTA
ATFQSAGFDSLTAVELRNRLMAATGAQTPASVVFDYPTPELLAGHLREQLLGAGSAAFST
TVATTPVADDPIAIIGMSCRFPGGVDSPEELWRLLESGTDAISAFPQDRGWDVAGGADDA
SVRAGGFLYTAAEFDPAFFGISPREAIAMDPQQRLLLEASWEVFERAGIAADALRGSPTG
VFVGTNGQDYAALVGNAPQRADGHLATGSAASVASGRLSYTFGLEGPAITVDTACSSSLV
AMHLAAQALRSGECRMALAGGATVMATPTAFAEFSRQGALAADGRCKAFAAGADGTGWGE
GVGILLLERLSDAERNGHRVLAVMRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLA
ARDIDAVEAHGTGTTLGDPIEAQALLATYGQDRDADQPLWLGSIKSNIGHTQAAAGVAGV
IKMVMAMGHGVLPQSLHIDEPTPHVDWPAGRIALLAELLLAETERRDAAGISSFGVSGTN
AHVILEQASAVAEVEETETARTPELPAVPWVLSAGSEAGLRAHALRLRSFVSADVDLRPV
DVGWSLASTRAALSHRAVVVGADRDELVRELEAVAGGSGTIGEARTHSGVVFVFPGQGSQ
WVGMALELVESSSVFAGRLGECAEALGPLVEWSLWDVLGDEVALSRVDVVQPVLWAVMVS
LAELWRSFGVVPSVVVGHSQGEIAAACVAGALSLEDGARVVALRSKALLALSGRGGMVSV
PVSADRLRDRPGLSVAAVNGPVSTVVSGSVEVLDAVLEEFPEAKRIPVDYASHSVQVEEI
REGLAEALASVRPRTGEVPFYSTVTGRLMDTVELDAGYWYRNLRETVEFRSAVEGLLELG
HTVFVEASPHPVLTIGIQDTADATDTTHTDILVTGSLRRDDGGPARFLTALAELFVRGVR
GRRQAFEGTGARHIDLPTYPFQRERFWVEPTAPGVVRDTDATTADGDFWAAVEREDTASL
AATLQVDGESLGDLLPALSAWRRRRHERSALEAIRYQVNWKPLVDDRPVTLSGVWLVVVS
QADADHEWVSGVSETLAEHGAEPVVCLVDERHLDRVVLADRLTSMTDTSSRTSTSSPSGT
TSAASISGVVSLAALDQRPHPDFASVPIGFAMTVLLTQALDDACLEAPLWSLTQSAVSTG
PADILLTPAPAQALVWGVGRVIALEQPRRWGGLIDLPTEVNTRARARLARVLSGVSGEDQ
VAIRAVGAFGRRLAHAPALRTDLPSWQPSGTVLVTGGTGALGGHIARWLAHQGAEHLVLT
SRRGMAAPGAPELVADLEAAGAAVTVAVCDVAERAQLAELVAEVGPLTAVVHTAALLDDA
TVDSLTTEQLHRALRVKVDGAMHLHELTRDMELSAFVLFSSLSGTVGTPGQGNYAPGNAF
LDALAEHRKAEGLVATSVAWGLWAGGGMGAGEAGEVARRHGVPALSPELALVALRTAVEQ
GDAVVTVADIAWERHYAAFTATRPSPLLADLPEVRRLIEAGAAAVVEETDLDRSGLRGRL
AGLDEAEQRRLLLDLVRRNVAVVLGHTDPEAVPSHRVFQELGFDSVTAVEFRNRLGAATG
LRLPATAVFDYPTPLALAEYARSELLGTAGEPLRAEPSGSFVDDDPIVIVGMSCRFPGGV
SSPEDLWNFLAEGGDAMSAFPGDRGWDLAGLFHSDPGHPGTSYTRTGGFLRDATAFDADF
FGISPREAVAMDPQQRLLLEASWEAFERAGIDPRSLRGSETGVFAGTNGQDYVSLLGGDQ
PQEFEGHVGTGNSASVMSGRIAYVLGLEGPALTVDTACSSSLVALHLAVQALRSGECSLA
LAGGVTVMATPGLFVEFSRQRGLAADGRCKAFAGAADGTGFSEGVGMLVVERLSDAERNG
HRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANARLSAVDVDAVEAHGTGTALG
DPIEAQALLATYGQGRDVGRPLWLGSVKSNIGHAQAAAGVAGVIKMVMAMRHGVLPRTLH
VDEPSPHVDWSAGAVELLTGQVVWPEVDRPRRAGVSAFGVSGTNAHVVLEQAPEVTEPEA
ERAELPAVPWVVSGVGEVAVRAQVERLREFVDRNADLDPVDVGWSLASARAGLSHRAVVV
GADRDELLGGLGSVVVGVSAGGGLGVLFAGQGSQRLGMGRGLYEAYPVFAVAWDEVCAQL
DRYVDRSVGEVVWGGDAELIGETAYTQAGLFALEVALYRLIASWGVKPDYLLGHSIGELA
AAYVAGVWSLEDAAKVVAARGRLMQVLPSGAVMVAVAASEGEVRELLTHGWPLPPVNGPE
SVVISGDEDAVQAVVDVLVGRGARARRLRVSHAFHSARMDGMLAEFGEVLDGVEFHAPSV
PVVSNVTGVVAGEELCSAEYWVRHVRETVRFADGLATLRELGVGSFLELGPDGTLTGLAD
GDGVPVLRRDRPEPVSVMAALGGLYVRGVEVDWGGVFPGARRVDLPTYAFQRERFWLEPS
PVQPTTSAVDAAFWDVVERGDAQALGVDVGQPLSAALPALASWRRARQEESVIDGWRYRL
GWTPIPAVSGELGLTGTWLVVVEPDADGTDVADALRSAGAEVRVVTVDELGAGSVAGVVS
LLSVEATVSLVRGLVAVGGDAPLWCVTRGAVCVVDGDVVDPYASAVWGLGRVIGLEHPDR
WGGLIDLPMEADAPVGALLAGVLAGHTGEDQVAIRAAGAWGARLARATPGADTFAAWRGR
GAALITGGTGVLGGHVARWLSGTGVEHIVLTSRRGMATPGATELVTELEELGVQVTVAAC
DVADRDAVATLLATIPDLRVVVHAAGVPSWGALDSLTPDEFEESVRSKVAGAANLDALLA
DAELDAFVLFSSVAGVWGSGSQSAYAAANAFLDGLAWRRRGVGLVATSVAWGMWGGGGMA
VGGEEFLVERGVSGMAAGLAVVALGRALCDGETALVVADVDWERFGSRFTALRPSPLLSE
LIPDTSEPLTPTVGAFAVELHGLSREDRDRTVTELVRAHAAEVLGHQSPTAIGLDRTFQE
LGFDSLTAVELRDRLSTATQLRFPASVIFDYPTPAALAEHVCGTALGLAEEIQIPQTPSA
VDDDPIVIVGMSCRFPGGVDSPEALWRLVSVGDDAVSPFPSDRGWDLAGVYDADATRSGR
SYVRSGGFLHDAAEFDAGFFGISPREATAMDPQQRLLLETAWEAFERAGIPASTLKGSQT
GVFVGASTQGYGRGDGQAPEGSEGYLLTGNASSVVSGRVAYTFGLEGPAVTVDTACSSSL
VALHWAVRALRSGECSLALAGGVTVMATPATFVEFSRQRGLAADGRCKSFAAGADGTGWS
EGAGMLLVERLSDAERNGHPVLAVVSGSAVNQDGASNGLTAPNGPSQQRVIRQALASAGL
AAQDVDAVEAHGTGTRLGDPIEAQALLATYGQDRDADRPLWLGSLKSNIGHTQAAAGVAG
VIKMVMAMRHGVLPPSLHIDEPTPHVDWSAGAVELLTGQVVWPDVDRRRRAGVSAFGVSG
TNAHVIVEQAPEVAEEPQVERGELPAVPWVVSGSGEAAVRAQVERLLAFTDRNPDLHPVD
VGWSLAATRSVLSHRAVVVGADRDELLGGLGSVVVGVSAGGGLGVLFAGQGSQRLGMGRG
LYEAYPVFAVAWDEVCAQLDRYLDRSVGEVVWGGDAELIGETAYTQAGLFALEVALYRLI
ASWGVKPDYLLGHSIGELAAAYVAGVWSLEDAAKVVAARGRLMQALPPGGAMVAVAASEG
EVRELLTDGWRLLYAVEEMFITGGVRTRRLRVSHAFHSARMDGMLAEFGEVLNGVEFHAP
SLPVVSNVSGEVAGEELCSAEYWVRHVRETVRFADGLDTLRELGVGSFLELGPDGTLAAL
TDGDGLPVLRRDRPEPVSVMAALGGLYVRGVEVDWDAVFPGGRRVDLPTYAFQRQRFWLE
SASAQPETSAVDAAFWDVVERGDVRALGIDGEQPLSAALPALASWRRARQERSDIDGWCY
RLDWTPVPAVSGELGLTGTWLVVVEPGADGTDVAAALRSAGADAEVVTSVELGAGPVAGV
VSSLSVEATVSLLQALVAAEVDAPLWCVTRGAVSVVDGDLVDPDQAGIWGLGRVIGLEHP
DRWGGLIDLPAELDDRAGEALVGILAGDTGEDQIAIRANGTWGARLTRATPTGEVRTGGV
MAGGAMPTGGLMAGEVARTGEAAADGATPTGGAGEASTAWRGRGTALVTGGTGALGRQVA
RWLVDSGVERIVLTSRRGAEAPGAAELVAELGSRVRVVACDVADREALAALLSTIPDLRT
VVHAAGVLDDGVLESLTPERIRAVMRAKADGARHLHELTNGTDLDAFVLFSSAAGTVGNA
GQGSYAAANAVLDGLAQRRRAEGLVATSVAWGAWAQSGMAAGVARSQGMDARSALAALGL
VLAADETMVMVADIDWATFGARFTAARPSPLLGELLGDGSGPTEPTGGEPADAFATRLEA
MADRERAATVLDLVRSHVAAVLGHTASEAIDPARPFQEIGFDSLTAVELRNRLTAATGVR
LPASAIYDYPTPEALAEHVCREALGVGGRIPAPAAPRPVDDEPIAIIGMSCRFPGGVSSP
EDLWGLLAEGRDAVSEFPADRGWNLAELYDPDPDRPGSSYVRAGGFLDDAAAFDPGFFGI
SPREALAMDPQQRLLLEVAWEAFERAHMSPATLKGSRTGVFVGTNGQDYAALASGAPQSA
EGYLGTGSAASVASGRLAYTFGLEGPAVTVDTACSSSLVALHLAAQALRSGECSLALAGG
ATVMATPAAFLEFSRQRALAADGRCKAFAAAADGTGWGEGVGMLLVERLSDAERNGHRVL
AVMRGSAVNQDGASNGLTAPNGPSQQRVIRQALANARLSATDIDVVEAHGTGTSLGDPIE
AQALLATYGQERPEEKPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDEP
SPHVDWTVGQVELLVEAREWPRNGAPRRAGVSSFGVSGTNAHVIVEQGPEVARPDQVRGL
EPVSASVPVPVPVPETLPVAESEPEPGSELESLPAPGLEPSPLPESARERSMPVPWVLSG
AGEAGLRAQVERLASFIDAHPGLDPADVGWTLVASRSLQAHRAVVVGTDLAELRRGLDTV
STDGAAQPGRKVVFVFPGQGSQWVGMALELLEFSPVFARRMRECADALAPFVEWSLFDVL
GDEAALGRVDVVQPVLWAVMVSLAELWRSYGVVPSAVVGHSQGEIAAACVAGGLSVEDGA
RVVALRSKALLALSGRGGMVSVPVSADRLRNRPGLSVAAVNGPASTVVSGAVEVLDTVLA
EFPEAKRIPVDYASHSPQVAEIQRELADALAPVRPRGGQVGFHSTVTGRLIDTSELDPDY
WYRNLRHTVEFQSTVEALIRQGHTVFVEVSPHPVLTVGIQDTVDTAVTADTTPIADATDA
TDGTGGTGAVGADIVVTGSLRRDDGGPVRFLTALADLYTRGVDVDWRPVFTRARTVDLPT
YAFQRERFWLKPARAVTQASGLGLGDIEHPLLGAVLPLPGAEGGVLTGLLSLDGQPWLAD
HMVQGTVVFPGTGFVELALQAGQHFGHPVVEELTLQAPLVVPGQGGVQIQVAVSTADERG
RRPVTVHSCRAGEWVLHASGTLGAMGDLDVTETYPTEVARSLEVWPPEGARRVDVSGMYE
TMAERGYGYGPAFQGLRAAWTRDDAIYAEVALEPEAQDVAARCGAHPALLDAALHGVGLG
RFLADPGQAYLPFSWNGVVLHAVGASAIRVVLSPAGPDAVSLEVADPTGAPVLSVASLAL
RPLSGRRIADTRGVDQDSLFRVDWAETPLPIATAGSAPDEFDVSAKSDSPVKFDAPVEYD
ALAPDAPVPHIVALTCESAGDAVSAVVCRVLAVVRRWLADERCARSRLAVLTRGAVATAP
GESVDDLGAAAVWGLLRSAQAEHPDRFVLIDHDGHQDSRTALAAALTAAAAGGHAHLALR
RGRALTPQLAPLTPSVTAPSVTIPSGATPPVTNPSAATPALEDGVPWRMDVTSQGTLENL
AAVPCPEAAGALGAGQVRVAMHAAGVNFRDVVVALGMIPGQDVIGSEGAGVVLDIGPGVS
DLAPGDRVMGLFSGAFGPVALTDHRLLARLPEGWSFADAAATPVVFLTAMYGLMDLAGLR
PGESVLVHSAAGGVGMAATQVAHWLGAEVYATASPGKWDTLRAGGVADDRIASSRSLEFA
DRFGRVDVVLNSLAGEYVDASLGLLADGGRFLEMGKTDIRDGDRVAAVHGVRYQAFDLMD
AGPDRVGELLRLLVSLFERGAFTALPTRAWDVRRAGDALRFLSQARHIGKLVLSIPRPLR
EGDTVLITGGTGTLGGLVARHLVERHGVRDVVLAGRRGPDAPGAAELAGALREHGAQVRV
VACDVADRDELARLLDTIPRLRMVVHTAGVLDDGVIESLTPERVREVLRPKVDAAWHLHE
LTADRELAEFVVFSSAAGVLGSPGQGAYAAANAWLDALMARRRAAGLPGLSVAWGLWAER
SGMTGHLSDRDLARMARAGATPLATEQGLRLLDSARAATEAVVLATPLDAAALRAQADAG
ALPALFRGLVRAPIRRATGAGPVEDESSLRGRMAAMPAAERQQLVLDLVRTQVATVLGHG
TPAAVDTARTFAEAGFDSLTAVELRNRLRTTTGVRLPATAIFDYPTPAVLAGHLLRELDG
TADVAVARAAAPAAATDRDPIVIVGMACRYPGGVTSPEELWELLDTGRDAVSDLPDDRGW
DLDGLYSADPDSSGTSYVRAGGFVHDAGEFDADFFGISPREALAMDPQQRLLLEVAWETV
ERAGIPVASLKGSQTGVFVGAASQGYGTGAGQAAEGSEGYFLTGGAGSVVSGRLSYTFGL
EGPAVTVDTACSSSLVALHLAAQALRSGECSLALAGGVTVMATPGIFVEFSRQRGLAADG
RCKAFADAADGTGWGEGVGMLLLERLSDARRNDHRVLAVVRGSAVNQDGASNGLTAPNGP
SQQRVVRAALANAGLAASEVDAVEAHGTGTSLGDPIEAQALLATYGQERERPLLLGSIKS
NIGHTQSAAGVAGVIKMVLAMRHGTLPRTLHVDEPSTHVDWSAGAVELLTRPAEWPGTSR
PRRAGVSSFGVSGTNAHVILEQSPTESGTDPRQAPERAPAVVPWVLSGQGERGLRAQAER
LRSFLAAHPESGPADVGWSLAATRSALSHRAAVVGADRAELLDGLAALAAGEPAPGVALG
TAGPGRVGVLFAGQGTQRAGMGRELYQAFPVFAAAWDEVCAALDPHLDRPLGEVVTDTTG
ELDTTGALDATAYAQAGLFALEVSLFRLVSSWGVRPDYLLGHSIGELAAAYVAGVWSLED
AAKVVAARGRLMGALPPGGAMVALAAPEDQVRPFLTDRIALAAVNGPSSVVVSGDEDAVR
GVAEAFAARGVKTRRLRVSHAFHSPQMDGMLIAFGEVLGTVDFRTPRIPVVSNLSGAVAG
EELCFPAYWVRQVRETVRFAAGLERLRELGTDTFLELGPDGTFTALAQAQVTGADAEFIP
TLRADRPEPVTVTTALAQLYTHGVEPDWSAAFPGARRTELPTYAFQRSRFWLEPSRTPGD
AAGFGLGALDHPLVGARVPLPDADGVLLTGRVSADAHPWLTGRRVLGVPLFPATGFLELV
LQAGLQYDCRTVDELTIHEPLVLPERGAVEVQVSVRGADESGRRPVTVYCRRDQRWVRYA
TAVLGADRPPAPEHPETWPPTGARPLESGGTPAWRRGDEVFLDIELPEVAGAGRWTLHPA
LLDQALRGEALAGLVTAPEGAHLPFSWTGITLHTTGATRLRVTLAPVGPDTVSLQVADAA
GTPVLSVDSLVLRPVSGQRLRQANAALFRPVWAACRTRPEPDTGTVRWALVGDPDAWKDA
WKDAWKDAWKDAWKDAWEDVWEDAWEPDMFGAPVAVYPDLSTIEDVPDIVLLPCVSEGGT
ASEVAVRVSEAVRTWLAGERFATSRLVLVTRGALATAAGEDVEDLAAAAVWSLVEPLQAA
EAGRLTLVDTDRWDLRTLRAAVAVEEDRVAVRTGAVLVPDLATAVATEQDPPAWGPGTVL
VTGGSAAAVARHLIAEHGVRDLVLAGDGDVAELAALGATVRLAPCDPADDQALAELLAEI
PGLRSVVHTTADAPERTRAGALSPETLRPQLRSGVAAAWNLHLATRGLELDRFVLFTSGA
GTLGSAYADALAAHRRALGLPAVSVSTDLGLALFHEACAGPGEAVRVTTATPVPARTEAV
RQPVEQAPAAEASATTLLERLAGRTEDEQDEILLELVRGQVAMVLGHPDATMVDPDRGFV
DMGFDSVAAVKLRNQLAGATRLDLPASLTFDHPTAVDLARHLRAEMLPDDAAAAILVLEE
LNKLDDSILVLDPGSAARVRISTLLQDLAAKWVERADPHALSEYVERSAETLIDAFASRG
EAELITEYASVIPLLVFNQLFGARPADGPKLVETMMKLFDSGEDAAAANDELLHWISGLL
AEKRRQPAADVTSWLMAHPSQLADDELMQQMILLMAAGTDPEQNLIANALRLLLSDDRFA
GELSGGSMPVEDALDEVLWNDPPMANYGTRFPRYDCDVAGVRLRKGDPVLISYAAANHEA
ALASDRRSGNRAHLAWSAGAHRCPAERPARVIASVAIERLLDRLPDMELAVPAERLTWRT
GPFSRALATLPVRFPAQATSRTGPSAASVSESTRFDETSGGSQWNPVPSFSTPPAATSPE
RQPESQQAARRRLLSFLTAWWRGQ
selected fasta
>polyketide synthase [MerC]
ATGAGCAGCGAGAACGTCCGACCGGGAATCGAGGGGGCTGGCACGCGGATGTCGAACGAC
GAAAAGGTACTCGAGTACCTCAAGAAGCTCACCGCCGATCTGCGCCAGACGCGTCAGCGC
CTCCAGGACGTCGAGGCCAAGAGTCGCGAGCCGATCGCGATCGTCGGTATGAGCTGCCGT
TTCCCGGGCGGGGTGAGCTCGCCGGAAGACCTGTGGCGGCTGACGGAGTCGGCGGTGGAC
GCGGTCTCCGGCTTCCCCACCGACCGAGGCTGGGACCTGGACGGCCTGTACGACCCCGAC
CCGGATCGCGCGGGCCGGTCGTACGCCCGCGAGGGCGCGTTCATCCCCGATGCCGGACAC
TTCGACGCCGGCCTCTTCGGGATCTCGCCGCGTGAGGCGCTGGCGATGGATCCGCAGCAG
CGGCTGCTGCTGGAGGCGTCGTGGGAGGCCCTGGAGCGTGCGGGTATCCCGACCGACTCC
CTGAAGGGCAGCCGGACCGGTGTGTTCGCCGGACTGATGTCTTCCGACTATGTCTCGCGG
CTGCCGGAGGTCCCGGACGAGCTCGAGGGATACGTCGGAATCGGAAGCGCGGCGAGTGTC
GCCTCCGGCCGTGTGTCGTACACGCTGGGGCTCGAGGGTCCGGCGGTCACGGTGGATACG
GCGTGTTCGTCGTCGTTGGTGGCGTTGCATCTGGCGGTGCAGGCGTTGCGGTCGGGTGAG
TGTTCGCTGGCGCTTGCGGGCGGTGTCACGGTGATGGCGACACCTGGCACCTTTGTCCAG
TTCTCCCGGCAGCGCGGCCTGGCCGCCGACGGCCGGTGCAAGGCGTTCGCGGCGGGCGCG
GACGGCACCGGCTGGGGCGAGGGCGTCGGCATGCTGGTGGTGGAGCGGTTGTCCGATGCT
GAGCGGAACGGTCACCGGGTGTTGGCGGTGGTGCGGGGTAGTGCGGTGAATCAGGATGGT
GCGTCGAATGGTTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATTCGTCAGGCG
TTGGCGAATGCGCGGTTGTCGGCGGTGGATGTGGATGCGGTGGAGGCGCACGGTACGGGT
ACGGCCCTGGGCGATCCGATCGAGGCGCAGGCTCTGCTGGCCACCTATGGTCAGGATCGG
GATGGGGACCGGCCGTTGTGGTTGGGTTCGGTGAAGTCGAATATTGGTCATACGCAGGCT
GCGGCGGGTGTGGCTGGTGTGATCAAGATGGTGATGGCGATGCGGCACGGGGTATTGCCG
CGGACGCTGCACGTGGATGAGCCCTCCCCGCATGTGGATTGGTCTGCCGGTGCGGTGGAG
TTGTTGTTGGGGCAGGTGGCGTGGCCGGATGTGGATCGGCCGCGTCGGGCGGGTGTGTCG
GCGTTCGGGGTGAGTGGGACGAACGCGCATGTGATGTTGGAGCAGGCGCCCGAGGTGGCG
GAGGGGTCTCGGGACGAGGGTGTTGCGTTGCCTGCGGTGCCGTGGGTGGTGTCGGGTGTG
GGTGAGGCGGCGGTGCGGGCTCAGGTGGCGCGGTTGCGGGAGTTTGTGGTGGGTGATCCT
GGGTTGGATCCGGTGGATGTGGGGTGGTCGTTGGCGAGTGCGCGTGCCGGGTTGTCGCAT
CGTGCGGTGGTGGTGGGTGCGGATCGTGATGAGTTGTTGGGTGGGTTGGGTTCGGCGGTG
GTGGGTGTTCCGGTGGTGGGTGGACTGGGTGTGTTGTTTGCCGGTCAGGGGTCGCAGCGG
TTGGGGATGGGGCGTGGGTTGTATGAGGCGTATCCGGTGTTCGCTGCGGCGTGGGATGAG
GTGTGCGCTCAGCTGGACCGGTATCTGGATCGGTCGGTGGGTGAGGTGGCGTGGGGTGAT
GATGTTGAGCTGATCGGGGAGACGGCGTATACGCAGGCGGGGTTGTTCGCGCTTGAGGTG
GCGCTGTATCGGCTGATCGCTTCGTGGGGTGTGCGGGCGGATTATCTGCTGGGTCATTCG
ATTGGTGAGTTGGCTTCGGCTTATGTGGCGGGTGTGTGGTCGTTGGAGGATGCGGCGAGG
GTGGTGGCGGCTCGGGGTCGTTTGATGCAGGGGTTGCCGTCGGGTGGGGTGATGGTTGCG
GTGGCGGCGTCGGAGGGTGAGGTGTTGCCGCTGCTGGCGGATGGGGTGGCGGTTGCGGCG
GTGAATGCTCCCGAGTCGGTGGTGGTCTCGGGTGATGAGGATGCGGTTCAGGCGGTTGTG
GATGTGTTGGTTGGGCGGGGGGTGCGGACGCGGCGGTTGCGGGTGAGTCATGCGTTTCAT
TCGGCTCGTATGGACGGGATGCTCGCCGAGTTCGGCGAGGTCCTGGACGGTGTCGAGTTC
CACGCTCCGAGCCTGCCGGTGGTGTCGAACGTGTCCGGTGTGGTGGCCGGTGAGGAGCTC
TGCTCACCGGAGTACTGGGTGCGTCATGTGCGGGAGACCGTCCGGTTCGCTGATGGGCTG
GCGACGTTGCGTGGGCTGGGCGTTGGTTCGTTCCTGGAGCTGGGGCCGGACGGGACGTTG
ACCGCGCTGGCCGACGGCGATGGTGTGTCGGTGTTGCAGCCGGGTCGTCCCGAACCGACT
GCGGTCATGGCGGCTTTGGGCGGGCTGTACGTCCGGGGTGTGGAGGTGGACTGGGGCGCG
GTGTTCCCGGGTGCTCGGCGGGTTGATTTGCCGACGTATGCCTTCCAGCGTGAGCGGTTC
TGGCTGGAGCCGTCCCCGGTGCAGCCCACCACGAGCGCCGTTGACGCGGCGTTCTGGGAC
GCGGTCGAACGTGGCGATGCGGAGATTCTTGGGGTTGATGCTGAGCAGCCGTTGAGTGCC
GCATTGCCTGCCTTGGCGTCGTGGCGGCGAGCGCGTCAGGAAGAGTCGGTCATCGACGCA
TGGCGGTATCGGCTGACCTGGGCCCCGGTCGTGGGTCCTTCTTCGCAGCTCTCCGGCCTG
TGGTTGGTGGTGGTCGAGCCGGACGAGGAGGAGACGGACGTTGTCGCCGCGCTGCGAGGC
GCTGGTGCCGAGGTGCGTGTCGTAACGGTCGATGAGCTGGGTGCGGGTCCGGTTGCGGGT
GTGGTGTCGTTGTTGTCGGTTGAGGCGACGGTGTCGCTGGTGCGGGGTCTTGTGGCTGCT
GGGGGCGATGCGCCGTTGTGGTGTGTCACTCGGGGTGCGGTCTGTGTGGTGGACGGGGAT
GTGGTGGATCCGTATGCGTCGGCTGTCTGGGGTCTGGGTCGTGTGATCGGGTTGGAGCAT
CCGGACCGTTGGGGCGGGCTGATCGATCTGCCCACCGCATGGGATGAGCGAACCTCGGAT
CTGTTGTGCTCGGTGCTTTCGGGCGCCACAGGTGAGGACCACACAGCGATCCGTGGCAAC
GAGGTGTTGGGCTGTCGTCTGAGCCGGGCGACGACGTCGGGCCCGGGGCCGTCCACTGCC
TGGGAAGCGTCGGGGACCGCGCTGATCACTGGTGGAACGGGTGCCCTGGGGAGCCATGTC
GCCCGATGGCTCGCGGATACCGGCGTTGAAGAGATCGTGTTGACGAGCCGGCGAGGCGTG
GACGCTCCTGGAGCACGGGAACTGGTCGCCGAACTGTCGGCCACGGGTGTATCGACCCGC
GTCGTGGCGTGTGATGTGGCCGATCGGAACGCGGTTGCGGAGCTGATCGGGACCATTCCG
GATCTTCGCGTGGTTGTGCACGCCGCGGGAGTACCGAGCTGGGGCCCGTTGAGCGCCCTA
ACCGCGCAGGACCTTCAGGATGGAATGCGGGCCAAGGTCGCGGGAGCCATCCACCTGGAT
GAGCTGACGCGTGATATGTCCTTGGACGCCTTTGTGTTGTTTTCGTCGGTGGCGGGGGTG
TGGGGGAGCGGGAGTCAGTCGGCGTATGCGGCGGCGAATGCGTTTTTGGATGGGTTGGCG
TGGCGGCGTCGTGGTGTTGGGTTGGTGGCGACGTCGGTTGCGTGGGGTATGTGGGGTGGC
GGTGGTATGGCGGTTGGTGGTGAGGAGTTTTTGGTTGAGCGTGGTGTGTCGGGGATGGCT
CCGGGGTTGGCGGTTGTGGCGTTGGGGCGGGCGTTGTGTGATGGTGAGACGGCGCTTGTG
GTGGCGGATGTGGACTGGGAGCGGTTCGGGGCGAGGTTCACCGCGCTGCGTCCGAGCCCT
CTGCTGAGCGAACTGATCCCCGACGCCGCCGACTCGGCGGCTCCGCTGGGCGAATTCGCG
GCCCGTCTCCAGACCATGTCCGAGGGCGACCGCATGCGCGCGGCCGTCGAGCTGGTGCGC
GTTTCGGCCGCGGCGGTGCTGGGGCACCAGGGGCCGGAGGCCATCGACCCCGGCAGGACG
TTCCAGGAGATCGGCTTCGACTCGCTGACCGCCGTGGAGCTGCGCAATCGGATCGCCACG
GCCACCGGTATCCGACCGCCGGCCACGATGATCTTCGACTATCCGACCCCTGCGGCCCTC
GCCGAGTATCTGACCGTGGAATTGCTCGGTTCGCCGCAGGACAGTGTGCCGCCGATACAG
GTGGCCGCACCGGACGACGGTGATCCCATCGTCATCGTCGGCATGAGTTGCCGCTTCCCC
GGGAATGTCGAGTCTCCCGAGGACCTGTGGCGGCTGATCGACTCCGACGGCGATGCCATA
ACGGCCTTCCCGACGGACCGTGGATGGGACCTGACCAGCCTCTACGACACGGCTGCGGGG
GAGCCGGGGACGTCGTATGCGCGTGTCGGCGGGTTCGTCCACGGCGCGGGCGAGTTCGAC
GCCGGGTTCTTCGGTATCTCGCCGCGTGAGGCGCTGGCGATGGATCCGCAGCAGCGGCTG
CTGCTGCACGCGGCGTGGGAGGCGTTCGAGCGGGCCGGTATCCCGGCCGCGTCGGTCAGG
GGCAGCCGGACAGGAGTGTTCGTCGGAGCCTCCCCGCAGGGCTATGGCGCCGCCGAAGCG
TCGGAAGGCTATTTCCTCACCGGTAGTTCGGGCAGCGTCATTTCGGGTCGGGTGTCGTAC
ACGCTGGGGCTTGAGGGTCCGGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTG
GCGTTGCATCTGGCGGTGCAGGCGTTGCGGTCGGGTGAGTGTTCGCTGGCGCTCGCGGGC
GGTGTCACGGTGATGGCGACACCCACTGCTTTCGTGGAGTTCTCGCGTCAGCGTGGGCTG
GCCGCTGATGGCCGGTGCAAGTCCTTTGCCGCTGGTGCGGATGGGACGGGTTGGTCGGAG
GGTGTGGGGCTGCTGTTGGTGGAGCGGTTGTCGGATGCTGAGCGGAATGGGCATCCGGTG
CTGGCCGTTGTCTCCGGCTCCGCAGTGAATCAAGACGGTGCGTCGAATGGTTTGACGGCG
CCGAATGGTCCGTCGCAGCAGCGGGTGATTCGTCAGGCGTTGGCGAGTGCGGGGTTGTCG
GCGGTGGATGTGGATGCGGTGGAGGCGCATGGTACGGGTACGGCGCTGGGTGATCCGATC
GAGGCGCAGGCGTTGTTGGCCACCTATGGGCAGGGTCGGGATGTGGATCGGCCGCTGTGG
TTGGGCTCCGTGAAGTCGAACATCGGTCATACGCAGGCTGCGGCGGGTGTGGCTGGTGTG
ATCAAGATGGTGATGGCGATGCGGCATGGGGTGTTGCCGCGGACGCTGCATGTGGATGAG
CCCTCCCCGCATGTGGACTGGTCGTCCGGAGCGGTCGAGTTGTTGAGGGAAAGGCTGCTT
GGCCCGGAGATGAATCGGCCGCGTCGGGCGGGCGTGTCGTCGTTCGGGGTGAGCGGGACG
AACGCGCATGTGGTGTTGGAACAGGCGCCGGGGGTGGTGAAAGGGTCTCGTGGCGAGGGT
GTTGCGTTGCCTGCGGTGCCGTGGGTGGTTTCCGGTGTTGGTGAAGCGCCGTCCGGCCCA
GTGAACCATTCCGGAGTTGTGGACCGGAATGCGGATCTGGATCCGGTGGATGTGGGGTGG
TCTTTGGTGGCCACTCGGTCTGTGTTGTCGCATCGTGCCGTGGTGGTGGGTGCGGATCGT
GAGGAGTTGTTGGGTGGGTTGGGTTCGGTGGTGGTGGGTGTTCCGGTGGTGGGTGGACTG
GGTGTGTTGTTCGCTGGTCAGGGGTCGCAGCGGTTGGGGATGGGGCGTGGGTTGTATGAG
GCGTATCCGGTGTTCGCTGCGGCGTGGGATGAGGTGTGCGCTCAGCTGGACCGGTATCTG
GATCGGTCGGTGGGTGAGGTGGTGTGGGGTGATGATGCTGAGCTGATCGGGGAGACGGCG
TATACGCAGGCGGGGTTGTTCGCGCTTGAGGTGGCGCTGTTCGCGTTGGTGTCCTCGTGG
GGTGTGCGGGCGGATTATCTGCTGGGTCATTCGATTGGTGAGTTGGCTGCGGCTTATGTG
GCGGGTGTGTGGTCGTTGGAGGATGCGGCGAGGGTGGTGGCTGCTCGGGGTCGTTTGATG
CAGGGGTTGCCGTCGGGTGGGGTGATGGTTGCGGTGGCGGCGTCGGAGGGTGAGGTGTTG
CCGCTGCTGGCGGATGGGGTGGCGGTTGCGGCGGTGAATGGTCCCGAGTCGGTGGTGCTG
TCTGGTGATGAGGGTGCGGTTCAGGCGGTTGTGGATGTGTTGGTTGGGCGAGGGGTGCGG
ACGCGGCGGTTGCGGGTGAGTCATGCGTTTCATTCGGCTCGTATGGACGGGATGCTCGCG
GAGTTCGGCGAGGTCCTGAGCGGTGTTGAGTTCCACGCTCCGAGCGTGCCCGTGGTGTCG
AATGTGACGGGTGTGGTGGCGGGTGAGGAGTTGTGTTCGGCGGAGTACTGGGTGCGGCAT
GTGCGGGAGACCGTCCGGTTCGCCGATGGACTGGCCACGCTCCGCGAGCTGGGGGTTGGT
TCATTCCTGGAGTTGGGGCCCGATGGCACGTTGGCGGCACTGACCGATGGCGATGGGCTG
CCGGTCCTGCGCCGGGATCGTCCGGAGCCTCTGTCCGTCATGGCTGCTCTGGGCGGGTTG
TATGTCCGGGGCGTGGAGGTGGACTGGGACGCGGTGTTCCCGGGTGCTCGGCGGGTTGAT
TTGCCGACGTATGCCTTCCAGCGTGAGCGGTTCTGGTTGGAACCGGCCGCTGGTGAGCCC
TCGACGAGCGCGGTCGACGCGGCGTTCTGGGCTGCGGTCGAACGCGGGGACGTCGGATCG
TTCGGTATCGACACCGAGCAGACGCTCAGTACTGCACTGCCCGCCCTTTCGTCCTGGCGC
CGCCGTCACCAGGAGAGGTCGCTGGTCGAGTCCTGGCGGTACCGCCTCGACTGGTCCCCG
ATCGGGGCCGTTTCTGAGCTGCCGACTCTGCGCGGTACGTGGCTGGTGGTAGGCGACACC
GGAGACGAGGTGGCTGCCGTGTTGCGGGCCGCGGGGGCCGATGCGCGGGCTGTGACGACG
GCGGAACTGGGCGAGGTCGCGGCTGCGGGTGTGGTGTCGTTGTTGCCGGTCGAGGCGACG
GTGTCACTGGTGCAGGCACTGGGGACGGCCGGGATCGATGCGCCGTTGTGGTGTGTGACT
CGGGGTGCGGTGTCGGTGGTGGATGGGGATGTGGTGGATCCGGTTCAGTCGGGGGTGTGG
GGTCTTGGGCGGGTGATCGGGCTGGAGTATCCGGATCGTTGGGGTGGTCTGATCGACGTG
CCGGGGGTTGTGGATGAGGAGGTCGGTGTCTGGTTGTGTCGGGTGTTGGGTGGGGGTACG
GGGGAGGATCAGGTTGCGGTTCGTGGTGGTGGGGCGTGGGGTGCTCGGTTGGTGCGGGTG
GTGGGTTCGGGGTTGGGCGGGTCGGTTGTGTGGCGGGGTGGGGGGTCGGCGTTGGTGACG
GGTGGTACGGGTGCGTTGGGTGGTCATGTGGCGCGTTGGCTGGCGGGTGCTGGTGTGGAG
AACATTGTGCTGGTGAGTCGTCGGGGGTTGGCTGCGCCTGGGGTTTTGGGGTTGGTGGCG
GAGTTGGAGGGGTTGGGTGCTGTGGTTCGGGTGGTGGGGTGTGATGTGGGGGATCGGGAT
CAGGTGGTGGGGTTGTTGGAGGGGATTGTGGATTTGCGGGTGGTGGTGCATGCGGCGGGT
GTGCTGGATGACGGTGTGTTGGAGTCGTTGTCGGCTGGGCGGGTTGGTGAGGTGTGGCGG
GTCAAGGTTGGGGGTGCGTTGTATTTGGATGAGTTGACCCGGGGTCGGGATCTGGATGCT
TTTGTGTTGTTTTCTTCGGCTGCGGGGACTGTGGGTAGTGCGGGTCAGGGGAGTTATGCG
GCGGCTAATGCTGCTCTGGATGGGTTGGCTTGGCGGCGGCGGGCGGAGGGGTTGGTGGCC
ACGTCGGTGGCGTGGGGTGCCTGGGCCGACAGCGGCATGGGGGCCGGGCACACACGGACC
ATGGCACCACGGCTGGCGCTGGCTGCCCTTCAGCGAGCGTTGGACGACGATGAGACCGCA
CTGATGATCGCGGACATCGACTGGGAGCAGTTCGGCTCGCGGTTCGGCGCGGTGCGGCCC
AGTCCGCTGGTCGGTGAGTTGCTGGGTGGCGCCGCTCGTTCTACGCCCGCGGTGGGCGAG
TTCTCCGACCGGCTACGATCCCTCCCCCCGGCCGAGCGGGAACGAACCGTCCTTGAAATC
GTACGTGGCCAGGTGGCCGTCGTTCTGGGACATGCCACCCCGGCGGCGATCGATACCGCA
GCGACATTCCAGTCAGCCGGTTTCGACTCCCTGACCGCGGTCGAACTCCGCAATCGGCTC
ATGGCGGCCACCGGAGCGCAGACACCTGCCTCGGTCGTCTTCGACTACCCCACGCCGGAA
CTTCTCGCCGGCCACCTGCGGGAGCAACTGCTCGGGGCAGGATCGGCAGCCTTCTCGACG
ACGGTCGCCACGACCCCGGTGGCTGACGACCCGATTGCGATCATCGGCATGAGCTGCCGA
TTCCCCGGTGGTGTCGACTCGCCCGAAGAGCTGTGGCGGCTCCTGGAGTCGGGGACGGAT
GCCATTTCCGCCTTCCCACAGGACCGCGGCTGGGACGTGGCCGGAGGGGCCGATGACGCG
TCGGTCCGGGCGGGTGGCTTCCTCTACACGGCGGCCGAGTTCGACCCCGCGTTCTTCGGT
ATCTCGCCGCGTGAGGCGATCGCGATGGATCCGCAGCAGCGGCTGCTGCTGGAGGCTTCG
TGGGAGGTCTTCGAGCGGGCCGGGATCGCCGCGGACGCGTTGCGGGGCAGCCCCACCGGA
GTGTTCGTCGGCACCAACGGCCAGGATTACGCCGCCCTCGTCGGTAACGCGCCACAGCGT
GCGGACGGCCATCTGGCCACCGGCAGCGCGGCGAGTGTGGCGTCCGGCCGGCTGTCCTAC
ACCTTCGGGCTCGAGGGCCCGGCCATCACCGTGGATACCGCGTGTTCGTCGTCGTTGGTG
GCCATGCACCTGGCCGCGCAGGCGCTGCGCTCGGGCGAATGCCGTATGGCCCTTGCGGGC
GGCGCCACGGTGATGGCCACGCCCACCGCCTTCGCCGAGTTCTCCCGGCAAGGCGCGTTG
GCCGCTGATGGCCGGTGCAAGGCGTTCGCGGCGGGCGCGGACGGCACCGGCTGGGGCGAA
GGCGTGGGCATTCTCCTGTTGGAGCGGCTGTCCGACGCCGAACGGAACGGCCACCGGGTG
CTGGCGGTGATGCGTGGCTCCGCCGTCAACCAGGACGGTGCCTCGAATGGGCTGACGGCG
CCGAACGGTCCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTGGCGAACGCCGGGCTCGCC
GCCCGGGACATCGACGCGGTGGAGGCACACGGTACGGGTACGACGCTGGGTGATCCGATT
GAGGCGCAGGCTCTGCTGGCCACTTATGGCCAGGACCGGGATGCGGATCAGCCGCTGTGG
TTGGGGTCGATCAAGTCGAATATCGGGCACACTCAGGCCGCTGCCGGTGTCGCCGGTGTG
ATCAAGATGGTTATGGCTATGGGCCATGGTGTGCTGCCGCAAAGCCTGCACATCGACGAG
CCCACTCCTCATGTGGACTGGCCAGCCGGACGGATCGCACTGCTCGCCGAACTTCTCCTG
GCTGAGACGGAGCGCCGCGACGCCGCCGGAATCTCCTCCTTCGGCGTGAGTGGCACCAAC
GCGCATGTGATCCTCGAACAGGCATCTGCGGTAGCCGAAGTCGAGGAAACCGAGACGGCG
CGAACGCCCGAATTGCCAGCTGTTCCGTGGGTGCTCTCGGCAGGGAGCGAAGCGGGGCTG
CGGGCGCATGCCCTCCGGCTTCGGTCCTTCGTAAGCGCCGATGTTGATCTGCGTCCGGTG
GATGTCGGTTGGTCGCTGGCCTCGACCCGCGCGGCTCTGTCCCACCGTGCCGTGGTCGTG
GGCGCGGACCGCGATGAACTCGTCCGTGAGCTGGAGGCCGTGGCCGGTGGCAGCGGCACG
ATCGGCGAGGCCCGGACGCATTCCGGGGTGGTGTTTGTCTTCCCGGGTCAGGGGTCGCAG
TGGGTGGGGATGGCGTTGGAGTTGGTGGAGTCGTCTTCGGTGTTTGCGGGGCGGTTGGGT
GAGTGTGCGGAGGCGCTAGGGCCGTTGGTGGAGTGGTCGTTGTGGGATGTGTTGGGTGAT
GAGGTGGCGCTCAGTCGGGTGGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCG
TTGGCGGAGTTGTGGCGTTCGTTTGGTGTGGTGCCGTCGGTGGTGGTGGGGCATTCGCAG
GGTGAGATTGCGGCGGCGTGCGTGGCGGGTGCGTTGTCGTTGGAGGACGGTGCCCGGGTG
GTGGCCTTGCGGAGCAAGGCATTGCTGGCCCTGTCGGGCCGGGGTGGCATGGTGTCCGTT
CCGGTGTCCGCCGACCGGCTCCGCGACCGCCCCGGACTGTCGGTGGCGGCGGTGAATGGT
CCGGTGTCGACGGTGGTGTCCGGGTCTGTTGAGGTGCTGGATGCGGTGTTGGAGGAGTTC
CCGGAGGCCAAGCGGATCCCTGTGGACTATGCCTCGCATTCGGTGCAGGTGGAGGAGATC
CGGGAGGGGCTGGCGGAGGCGTTGGCGTCGGTCCGGCCGCGTACGGGTGAGGTGCCGTTT
TATTCGACGGTGACGGGTCGGCTGATGGACACCGTCGAGTTGGATGCGGGGTACTGGTAT
CGGAATTTGCGTGAGACGGTGGAGTTCCGGTCCGCGGTCGAGGGGCTGCTGGAGCTTGGT
CATACGGTGTTTGTCGAGGCCAGTCCGCATCCGGTGCTGACCATCGGCATCCAGGACACC
GCCGACGCCACCGACACCACCCACACCGACATCCTCGTCACCGGATCGCTACGCCGCGAC
GACGGCGGTCCGGCGCGCTTCCTCACCGCGCTGGCCGAGCTGTTCGTACGAGGGGTGCGC
GGACGGCGGCAGGCGTTCGAAGGGACCGGCGCCCGGCATATCGACTTGCCGACCTACCCC
TTCCAGCGGGAGCGCTTCTGGGTCGAGCCCACCGCCCCGGGCGTGGTCCGGGACACTGAT
GCCACCACCGCGGACGGCGACTTCTGGGCGGCCGTCGAGCGCGAAGACACCGCATCGCTG
GCGGCCACCTTGCAGGTCGACGGCGAGTCGCTGGGTGACCTGCTACCCGCCTTGTCGGCT
TGGCGCCGCCGGCGGCACGAGCGGTCCGCGCTGGAGGCCATCCGGTACCAGGTCAACTGG
AAGCCGCTTGTCGACGACCGGCCCGTGACGTTGTCGGGCGTTTGGCTCGTCGTGGTTTCC
CAGGCCGACGCCGACCATGAGTGGGTCTCCGGCGTAAGCGAGACGCTCGCTGAACACGGG
GCCGAGCCAGTGGTGTGCCTGGTGGACGAGCGGCACCTGGATCGTGTCGTGCTGGCCGAC
CGGCTGACGAGCATGACCGATACGAGCAGCAGGACCAGCACAAGCAGCCCAAGCGGCACG
ACGAGCGCGGCGAGCATCAGCGGCGTGGTGTCGCTGGCCGCCCTGGACCAGCGGCCGCAC
CCGGACTTCGCCTCCGTGCCCATCGGTTTCGCGATGACGGTGCTGCTGACTCAGGCGTTG
GACGACGCATGCCTGGAGGCACCGCTGTGGAGTCTGACCCAATCCGCCGTGTCCACCGGG
CCCGCTGACATCCTCCTCACGCCCGCGCCCGCGCAGGCACTGGTGTGGGGCGTCGGCCGA
GTGATCGCGCTTGAGCAGCCCCGGCGCTGGGGCGGGCTCATCGACCTGCCGACCGAGGTG
AACACGAGGGCACGGGCGCGGCTGGCGAGGGTCCTGTCAGGCGTTTCGGGCGAGGATCAG
GTCGCGATCCGGGCGGTGGGTGCCTTCGGGCGCAGGCTCGCCCATGCCCCCGCGTTGCGG
ACCGATCTGCCATCCTGGCAGCCGAGTGGGACCGTACTGGTCACCGGAGGCACCGGAGCG
CTGGGCGGCCATATCGCGCGGTGGCTGGCACACCAGGGCGCGGAGCACCTCGTGCTGACC
AGTCGGCGCGGCATGGCCGCGCCCGGGGCGCCCGAGCTCGTCGCAGACCTGGAAGCGGCC
GGAGCGGCAGTGACCGTTGCCGTGTGCGACGTGGCCGAGCGTGCCCAACTGGCCGAGCTG
GTGGCCGAGGTCGGCCCGCTGACGGCTGTGGTGCACACGGCCGCTCTGCTGGACGACGCG
ACGGTCGACTCCCTGACCACCGAGCAACTGCACCGGGCGCTGCGCGTCAAGGTCGACGGC
GCGATGCATCTGCACGAGCTGACCCGCGACATGGAACTGTCCGCGTTCGTGCTCTTCTCC
TCCTTGTCCGGGACGGTCGGCACACCAGGGCAGGGCAATTACGCACCGGGCAACGCGTTC
CTCGATGCGCTGGCTGAGCACCGTAAGGCCGAGGGCCTGGTCGCGACATCCGTGGCCTGG
GGCCTGTGGGCCGGTGGCGGGATGGGAGCGGGCGAAGCGGGCGAGGTGGCCCGGCGCCAT
GGTGTTCCCGCACTGTCCCCGGAGCTGGCGCTGGTCGCACTGCGTACGGCTGTCGAGCAG
GGCGACGCGGTGGTCACGGTTGCGGACATCGCATGGGAACGCCACTACGCCGCCTTCACC
GCGACGCGGCCCAGCCCCTTGCTGGCCGACCTTCCGGAAGTACGGCGACTCATCGAGGCG
GGGGCCGCTGCGGTCGTCGAGGAGACGGACCTGGACCGATCCGGACTCAGGGGGCGCCTG
GCCGGACTCGACGAGGCCGAACAGCGACGACTCCTCCTCGACTTGGTACGCCGCAATGTC
GCGGTGGTGCTCGGGCACACCGACCCGGAAGCCGTGCCGTCCCACCGCGTCTTCCAAGAG
CTCGGCTTCGACTCCGTGACGGCGGTCGAATTCCGCAACCGGCTGGGTGCCGCGACCGGT
CTGCGGCTCCCGGCGACCGCCGTATTCGACTACCCGACCCCGCTCGCCCTCGCGGAGTAC
GCGCGGTCGGAACTACTGGGAACGGCCGGAGAGCCCCTGCGCGCCGAGCCGAGCGGCTCC
TTCGTGGACGACGATCCGATCGTGATCGTAGGAATGAGCTGCCGCTTCCCCGGCGGGGTG
AGCTCGCCGGAGGACCTGTGGAACTTCCTCGCCGAGGGCGGGGACGCGATGTCGGCGTTC
CCTGGGGACCGTGGCTGGGACCTGGCCGGTCTCTTTCACAGCGACCCTGGCCACCCGGGG
ACCTCGTACACCCGGACAGGTGGCTTCCTCCGTGATGCGACCGCGTTCGACGCCGACTTC
TTCGGTATCTCGCCGCGTGAAGCGGTCGCGATGGATCCGCAGCAGCGGCTGCTGCTGGAG
GCATCGTGGGAGGCGTTCGAACGGGCGGGGATCGATCCTCGGTCGCTGCGGGGCAGCGAG
ACCGGAGTGTTCGCCGGCACCAATGGCCAGGACTACGTCAGCCTTTTGGGCGGAGACCAG
CCGCAGGAGTTCGAAGGCCATGTGGGAACGGGTAATTCGGCGTCGGTGATGTCCGGCCGG
ATCGCCTATGTTCTGGGCCTCGAGGGCCCGGCGCTGACCGTGGATACGGCGTGTTCGTCG
TCGTTGGTGGCGTTGCATCTGGCGGTGCAGGCGTTGCGGTCGGGTGAGTGTTCGCTGGCG
CTTGCGGGCGGTGTCACGGTGATGGCGACACCGGGATTGTTCGTGGAGTTCTCGCGCCAG
CGCGGCCTGGCCGCCGACGGTCGGTGCAAGGCGTTCGCGGGGGCCGCTGACGGCACTGGT
TTCTCCGAAGGTGTGGGGATGCTGGTGGTGGAGCGGTTGTCGGATGCTGAGCGGAATGGG
CATCGGGTGTTGGCGGTGGTGCGTGGTTCGGCCGTGAATCAGGATGGTGCGTCGAATGGT
TTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATTCGTCAGGCGTTGGCGAATGCG
CGGTTGTCGGCGGTGGATGTGGACGCGGTGGAGGCGCATGGTACGGGTACGGCGCTGGGT
GATCCGATCGAGGCGCAGGCGTTGTTGGCCACCTATGGTCAGGGTCGGGATGTAGGTCGG
CCGTTGTGGTTGGGTTCGGTGAAGTCGAATATTGGTCATGCGCAGGCTGCGGCGGGTGTG
GCTGGTGTGATCAAGATGGTGATGGCGATGCGGCATGGGGTGCTGCCGCGAACGCTGCAC
GTGGATGAGCCCTCCCCGCATGTGGACTGGTCTGCCGGTGCGGTGGAGTTGCTGACGGGG
CAGGTGGTGTGGCCGGAGGTGGATCGGCCGCGTCGGGCGGGTGTGTCGGCGTTCGGGGTG
AGTGGGACGAACGCGCATGTGGTGCTGGAGCAGGCGCCTGAAGTAACGGAGCCTGAGGCT
GAACGCGCGGAACTGCCTGCGGTGCCGTGGGTGGTGTCAGGTGTGGGTGAGGTGGCGGTG
CGGGCGCAGGTGGAGCGGTTGCGGGAGTTTGTGGACCGGAATGCGGATCTGGATCCGGTG
GATGTGGGGTGGTCTTTGGCGAGTGCGCGTGCCGGGTTGTCGCATCGTGCGGTGGTGGTG
GGTGCGGATCGTGATGAGTTGTTGGGTGGGTTGGGTTCGGTGGTGGTGGGTGTTTCGGCC
GGTGGTGGGTTGGGTGTGTTGTTTGCGGGTCAGGGGTCGCAGCGGTTGGGGATGGGGCGT
GGGTTGTATGAGGCGTATCCGGTGTTCGCGGTGGCGTGGGATGAGGTGTGCGCTCAGCTG
GACCGGTATGTGGATCGGTCGGTGGGTGAGGTGGTGTGGGGTGGTGATGCTGAGCTGATT
GGGGAGACGGCGTATACGCAGGCGGGGTTGTTCGCGCTTGAGGTGGCGCTGTATCGGCTG
ATCGCTTCGTGGGGTGTGAAGCCGGATTATCTGCTGGGTCATTCGATTGGTGAGTTGGCT
GCGGCTTATGTGGCGGGTGTGTGGTCGTTGGAGGATGCGGCCAAGGTGGTGGCTGCTCGG
GGTCGTTTGATGCAGGTGCTGCCGTCGGGTGCCGTGATGGTTGCCGTGGCCGCCTCCGAA
GGTGAGGTGCGGGAGCTGCTGACCCATGGGTGGCCGTTGCCGCCGGTGAATGGTCCCGAG
TCGGTGGTGATCTCGGGTGATGAGGATGCGGTTCAGGCGGTTGTGGATGTGTTGGTTGGG
CGGGGGGCGCGGGCGCGGCGGTTGCGGGTGAGTCATGCGTTTCATTCGGCTCGTATGGAC
GGGATGCTCGCCGAGTTCGGCGAGGTCCTGGACGGTGTCGAGTTCCACGCTCCGAGCGTG
CCCGTGGTGTCGAATGTGACGGGTGTGGTGGCGGGTGAGGAGTTGTGCTCGGCGGAGTAC
TGGGTGCGTCATGTGCGGGAGACGGTCCGATTCGCCGATGGACTGGCCACGCTCCGCGAG
CTGGGCGTTGGTTCATTCCTGGAGCTGGGACCTGACGGCACGTTGACGGGCTTGGCCGAT
GGCGATGGTGTGCCGGTCCTGCGCCGGGATCGTCCGGAGCCCGTGTCCGTCATGGCGGCT
TTGGGTGGGTTGTATGTCCGGGGTGTGGAGGTGGACTGGGGCGGGGTGTTCCCGGGTGCT
CGGCGGGTTGATTTGCCGACGTATGCCTTCCAGCGTGAGCGGTTCTGGCTGGAGCCGTCA
CCGGTACAGCCCACCACGAGCGCCGTGGACGCGGCGTTCTGGGACGTGGTCGAGCGCGGG
GACGCCCAAGCGCTCGGGGTCGATGTTGGGCAGCCGCTGAGTGCCGCGTTGCCTGCCTTG
GCGTCGTGGCGGCGGGCACGCCAGGAAGAGTCGGTCATCGATGGGTGGCGTTACCGGCTC
GGCTGGACGCCGATCCCGGCGGTGTCCGGGGAGCTGGGCCTCACCGGCACCTGGCTGGTC
GTGGTCGAGCCTGATGCGGACGGTACCGATGTGGCCGATGCGTTGCGGTCGGCCGGGGCC
GAGGTGCGTGTCGTAACGGTCGATGAGCTGGGTGCGGGTTCGGTTGCGGGTGTGGTGTCG
TTGTTGTCGGTTGAGGCGACGGTGTCGTTGGTGCGGGGTCTTGTGGCTGTTGGGGGCGAT
GCGCCGTTGTGGTGTGTCACTCGGGGTGCGGTCTGTGTGGTGGACGGGGATGTGGTGGAT
CCGTATGCGTCGGCTGTCTGGGGTCTGGGTCGTGTGATCGGGTTGGAGCATCCGGACCGT
TGGGGCGGGCTGATCGACCTGCCCATGGAGGCGGATGCGCCTGTGGGCGCGTTGCTGGCC
GGGGTTCTCGCCGGGCATACCGGGGAGGATCAGGTGGCAATCCGTGCGGCAGGGGCGTGG
GGTGCCCGACTGGCTCGGGCGACACCAGGGGCGGACACGTTCGCCGCGTGGCGTGGTCGA
GGAGCCGCCTTGATCACCGGAGGTACGGGTGTGTTGGGCGGCCATGTGGCGCGCTGGCTG
TCGGGAACCGGAGTAGAGCACATCGTGCTGACGAGCCGCCGGGGGATGGCGACCCCTGGT
GCGACCGAGCTGGTGACCGAGCTGGAGGAGCTCGGAGTCCAGGTGACGGTGGCCGCATGT
GATGTCGCCGATCGGGACGCGGTCGCGACCCTGCTGGCCACCATCCCCGATCTCCGAGTC
GTCGTGCATGCCGCGGGGGTGCCGAGCTGGGGCGCCTTGGACAGCCTGACACCCGATGAG
TTCGAGGAGAGCGTCCGGTCGAAGGTTGCCGGGGCGGCGAACCTGGACGCGCTCCTGGCG
GACGCCGAACTGGACGCCTTTGTGTTGTTTTCGTCGGTGGCGGGGGTGTGGGGGAGCGGG
AGTCAGTCGGCGTATGCGGCGGCGAATGCGTTTTTGGATGGGTTGGCGTGGCGGCGTCGT
GGTGTTGGGTTGGTGGCGACGTCGGTGGCGTGGGGTATGTGGGGTGGCGGTGGTATGGCG
GTTGGTGGTGAGGAGTTTTTGGTTGAGCGTGGTGTGTCGGGGATGGCTGCGGGGTTGGCG
GTTGTGGCGTTGGGGCGGGCGTTGTGTGATGGTGAGACGGCGCTTGTGGTGGCGGATGTG
GACTGGGAGCGGTTCGGGTCGCGGTTCACCGCGCTGCGTCCGAGCCCACTGCTGAGCGAA
CTGATCCCCGACACGTCCGAACCACTCACGCCGACGGTCGGTGCATTTGCTGTTGAGTTG
CACGGATTGTCACGCGAGGACCGGGATCGTACGGTCACGGAGCTCGTACGGGCACATGCT
GCCGAGGTGTTGGGCCATCAGAGCCCGACCGCGATCGGCCTCGACCGGACGTTCCAGGAG
TTGGGTTTCGACTCGCTGACCGCCGTGGAATTGCGGGACCGGCTCAGTACGGCCACTCAG
CTGCGATTCCCGGCCTCCGTGATCTTCGACTATCCGACTCCGGCGGCGCTCGCCGAGCAT
GTGTGCGGGACGGCGCTCGGGCTGGCCGAAGAGATACAGATACCGCAAACGCCGAGTGCG
GTGGACGACGATCCGATCGTGATCGTCGGGATGAGCTGCCGCTTCCCGGGCGGTGTGGAC
TCTCCGGAAGCCCTGTGGCGGTTGGTCAGCGTCGGTGACGATGCCGTATCGCCCTTCCCC
TCCGACCGTGGGTGGGACCTGGCCGGTGTGTACGACGCCGACGCGACTCGCTCGGGCCGG
TCGTACGTCCGCTCGGGTGGCTTCCTCCATGACGCGGCCGAGTTCGACGCTGGCTTCTTC
GGGATTTCGCCGCGTGAGGCGACCGCGATGGATCCGCAGCAGCGGCTGTTGCTGGAGACG
GCCTGGGAGGCGTTCGAGCGGGCCGGAATCCCGGCCTCGACGCTCAAGGGCAGCCAGACC
GGCGTCTTCGTGGGCGCGTCCACGCAGGGCTACGGCCGCGGGGACGGGCAGGCCCCGGAA
GGCTCCGAGGGATATCTGCTGACCGGCAATGCGAGCAGCGTGGTATCCGGTCGGGTGGCC
TATACGTTCGGGCTCGAGGGTCCGGCGGTCACGGTGGACACTGCGTGCTCGTCCTCGTTG
GTGGCGCTGCACTGGGCGGTGCGGGCCCTTCGATCGGGCGAGTGCTCCCTCGCGCTGGCC
GGCGGGGTGACCGTGATGGCGACACCCGCCACTTTCGTGGAGTTCTCGCGTCAGCGTGGC
CTGGCCGCCGACGGCCGCTGTAAGTCCTTCGCCGCCGGTGCGGATGGGACGGGCTGGTCC
GAGGGCGCCGGCATGCTGCTGGTCGAGCGGCTGTCGGACGCCGAGCGGAATGGGCATCCG
GTGCTGGCCGTTGTCTCCGGCTCCGCAGTGAATCAAGACGGTGCCTCGAATGGTTTGACG
GCGCCGAATGGTCCGTCGCAGCAGCGGGTGATCCGTCAGGCGCTGGCGAGCGCCGGGCTG
GCCGCCCAGGATGTCGACGCGGTCGAAGCGCATGGCACGGGCACCAGGTTGGGTGATCCG
ATCGAGGCGCAGGCGTTGTTGGCCACCTATGGTCAGGACCGGGATGCGGATCGGCCGCTG
TGGTTGGGGTCCTTGAAGTCGAATATTGGTCATACGCAGGCTGCGGCGGGTGTGGCTGGT
GTGATCAAGATGGTGATGGCGATGCGGCATGGGGTGTTGCCGCCTAGCCTGCATATCGAT
GAACCGACGCCTCATGTCGATTGGTCCGCCGGTGCGGTGGAGTTGCTGACGGGGCAGGTG
GTGTGGCCGGATGTGGATCGGCGACGTCGGGCGGGTGTGTCGGCGTTCGGGGTGAGTGGG
ACGAACGCCCATGTGATTGTGGAGCAGGCGCCTGAGGTGGCGGAGGAGCCGCAGGTCGAG
CGCGGTGAACTGCCTGCGGTGCCGTGGGTGGTGTCGGGTTCGGGTGAGGCGGCGGTACGG
GCGCAGGTGGAGCGGCTACTGGCCTTCACGGACCGGAATCCGGATCTGCATCCGGTGGAT
GTGGGGTGGTCATTGGCGGCCACTCGGTCTGTGTTGTCGCATCGTGCCGTGGTGGTGGGT
GCGGATCGTGATGAGTTGTTGGGTGGGTTGGGTTCGGTGGTGGTGGGTGTTTCGGCCGGT
GGTGGGTTGGGTGTGTTGTTTGCGGGTCAGGGGTCGCAGCGGTTGGGGATGGGGCGTGGG
TTGTATGAGGCGTATCCGGTGTTCGCGGTGGCGTGGGATGAGGTGTGTGCCCAGCTGGAC
CGGTATCTGGATCGGTCGGTGGGTGAGGTGGTGTGGGGTGGTGATGCTGAGCTGATCGGG
GAGACGGCGTATACGCAGGCGGGGTTGTTCGCGCTTGAGGTGGCGCTGTATCGGCTGATC
GCTTCGTGGGGTGTGAAGCCGGATTATCTGCTGGGTCATTCGATTGGTGAGTTGGCTGCG
GCTTATGTGGCGGGTGTGTGGTCGTTGGAGGATGCGGCCAAGGTGGTGGCTGCTCGGGGC
CGTCTGATGCAGGCGTTGCCGCCGGGCGGGGCGATGGTCGCGGTGGCGGCGTCGGAGGGT
GAGGTGCGGGAGCTGCTGACCGATGGGTGGCGGTTGCTGTACGCCGTCGAGGAGATGTTC
ATCACGGGTGGGGTGCGGACGCGGCGGTTGCGGGTGAGTCATGCGTTTCATTCGGCTCGT
ATGGACGGGATGCTCGCCGAGTTCGGTGAGGTGCTGAACGGTGTCGAGTTCCACGCTCCG
AGCCTGCCGGTGGTCTCGAACGTGTCCGGTGAGGTGGCCGGTGAAGAGCTCTGCTCGGCG
GAGTACTGGGTGCGCCATGTGCGGGAGACGGTCCGGTTCGCCGATGGGCTGGACACCCTC
CGCGAGCTGGGCGTTGGTTCATTCCTGGAGCTGGGCCCCGATGGCACGTTGGCCGCACTG
ACCGACGGTGATGGGCTGCCGGTCCTGCGGCGGGATCGTCCGGAGCCCGTGTCCGTCATG
GCGGCTTTGGGTGGGTTGTATGTCCGGGGTGTTGAGGTGGACTGGGACGCGGTGTTCCCG
GGTGGTCGGCGGGTCGATCTCCCCACCTACGCGTTCCAACGGCAGCGGTTCTGGTTGGAA
TCCGCCTCCGCCCAGCCCGAGACCAGCGCCGTTGACGCGGCGTTCTGGGACGTGGTCGAG
CGCGGGGATGTGCGGGCGCTGGGCATTGACGGGGAACAGCCGTTGAGTGCCGCACTGCCT
GCCTTGGCGTCGTGGCGGAGGGCGCGGCAGGAGCGGTCGGACATCGATGGCTGGTGTTAT
CGGCTCGACTGGACGCCGGTCCCGGCGGTGTCCGGGGAGCTGGGCCTCACCGGCACCTGG
TTGGTCGTGGTCGAGCCGGGTGCGGACGGTACCGATGTGGCCGCTGCGTTGCGGTCGGCC
GGGGCCGATGCCGAGGTCGTGACGTCGGTGGAGCTGGGCGCGGGTCCGGTTGCGGGCGTC
GTGTCGTCGTTGTCGGTCGAGGCGACGGTGTCGTTGCTGCAAGCCCTTGTGGCAGCCGAG
GTCGATGCGCCGTTGTGGTGCGTCACTCGCGGTGCGGTCTCGGTGGTCGACGGAGACCTG
GTGGATCCTGACCAGGCCGGAATCTGGGGCCTCGGCCGTGTCATCGGTTTGGAGCATCCG
GACCGCTGGGGCGGGCTGATCGACCTGCCAGCCGAGCTTGACGATCGCGCTGGGGAAGCG
CTGGTCGGCATCCTCGCCGGGGACACCGGTGAGGATCAGATAGCCATCCGTGCCAACGGC
ACATGGGGCGCCCGTCTGACGCGGGCGACGCCGACCGGTGAGGTGCGGACTGGCGGGGTG
ATGGCCGGTGGGGCGATGCCGACCGGTGGCCTGATGGCCGGTGAGGTGGCGCGGACCGGT
GAGGCGGCGGCCGATGGGGCGACGCCGACCGGTGGCGCTGGTGAGGCATCGACCGCATGG
CGTGGGCGTGGCACCGCCCTGGTCACCGGTGGTACGGGCGCACTGGGCCGCCAGGTGGCG
CGCTGGCTGGTGGACAGCGGTGTGGAGCGGATCGTGCTGACCAGCCGCCGGGGAGCCGAG
GCGCCCGGCGCCGCCGAGCTCGTCGCCGAGTTGGGGAGCCGAGTGCGTGTGGTGGCCTGT
GATGTCGCCGATCGCGAGGCGCTCGCGGCTCTTCTGTCGACGATCCCGGATCTGCGCACC
GTCGTGCACGCGGCGGGTGTCCTCGACGACGGTGTGCTCGAATCGCTGACCCCGGAGCGG
ATCCGCGCCGTGATGCGAGCCAAGGCCGACGGCGCACGCCATCTCCACGAGTTGACCAAT
GGCACCGACCTCGACGCCTTCGTGTTGTTCTCCTCGGCCGCCGGGACCGTGGGCAATGCG
GGCCAGGGGAGTTACGCGGCGGCCAACGCGGTCCTGGACGGGCTGGCTCAGCGGCGCCGG
GCCGAGGGGCTGGTGGCCACATCGGTGGCCTGGGGAGCCTGGGCCCAATCCGGTATGGCT
GCGGGAGTGGCGCGGTCGCAGGGCATGGATGCGAGGTCGGCGCTCGCCGCTCTGGGGCTG
GTGCTGGCCGCCGACGAGACCATGGTGATGGTGGCCGACATCGACTGGGCGACCTTCGGG
GCCCGGTTCACCGCCGCACGGCCGAGTCCGCTGCTCGGCGAGTTGCTCGGTGATGGGTCC
GGGCCGACCGAGCCGACGGGTGGCGAACCGGCCGACGCGTTCGCCACTCGCCTGGAGGCC
ATGGCCGACCGGGAACGGGCGGCCACCGTGCTGGACCTGGTCCGTTCGCATGTGGCCGCT
GTCCTGGGACACACGGCATCGGAGGCGATCGACCCGGCCCGGCCCTTCCAGGAGATCGGT
TTCGATTCGCTCACCGCGGTGGAGCTGCGGAACCGGCTCACCGCGGCCACCGGGGTACGA
CTCCCGGCCTCCGCGATCTATGACTACCCGACCCCGGAGGCGCTCGCCGAGCATGTGTGC
CGGGAGGCGCTGGGCGTGGGCGGACGGATACCGGCCCCGGCGGCGCCACGTCCGGTGGAC
GATGAACCGATCGCCATCATCGGGATGAGCTGCCGTTTCCCCGGCGGGGTGAGCTCGCCG
GAGGACCTGTGGGGGCTGCTGGCCGAGGGCCGCGACGCCGTGTCGGAGTTCCCGGCGGAC
CGCGGCTGGAACCTGGCCGAGTTGTACGATCCCGATCCCGACCGCCCTGGCTCCTCGTAC
GTCCGGGCGGGCGGATTCCTCGATGACGCGGCCGCGTTCGACCCCGGTTTCTTCGGGATC
TCGCCACGCGAGGCGCTCGCGATGGATCCGCAGCAGCGGCTGCTGCTGGAGGTTGCCTGG
GAGGCGTTCGAGCGCGCCCATATGTCCCCTGCCACGCTCAAGGGCAGCCGGACCGGGGTG
TTCGTCGGGACCAACGGCCAGGACTACGCCGCTCTGGCGAGCGGGGCCCCGCAGAGCGCG
GAGGGGTATCTGGGCACGGGCAGCGCCGCCAGCGTTGCCTCGGGCCGGCTGGCGTACACA
TTCGGCCTTGAGGGTCCGGCGGTCACCGTGGACACGGCCTGTTCGTCGTCGCTGGTCGCG
CTGCACCTCGCCGCGCAGGCCCTGCGTTCCGGCGAATGCTCCTTGGCCTTGGCCGGTGGC
GCGACCGTCATGGCCACCCCGGCGGCCTTCCTGGAGTTCTCCCGTCAGCGCGCTCTGGCG
GCCGATGGACGATGCAAGGCGTTCGCCGCGGCGGCTGACGGCACCGGCTGGGGCGAGGGC
GTCGGCATGCTCCTGGTGGAGCGGCTCTCCGACGCGGAGCGCAACGGCCACCGGGTGCTG
GCGGTGATGCGTGGCTCCGCCGTCAACCAGGACGGCGCTTCCAACGGGCTGACCGCGCCG
AACGGACCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTGGCGAACGCCCGGTTGTCCGCC
ACGGATATCGACGTCGTGGAGGCGCACGGTACCGGCACCAGCCTCGGCGACCCGATCGAG
GCGCAGGCGCTGCTCGCCACCTACGGTCAGGAGCGGCCTGAGGAGAAGCCACTGTGGCTC
GGCTCGGTGAAGTCCAACATCGGGCACACCCAGGCGGCCGCCGGTGTGGCCGGTGTGATC
AAGATGGTCATGGCCATGCGACACGGCGTACTGCCGCGGACCCTGCATGTCGACGAGCCC
TCGCCGCATGTGGATTGGACGGTGGGCCAGGTCGAGTTGCTCGTCGAAGCGAGGGAGTGG
CCGCGGAACGGAGCTCCTCGCCGGGCGGGCGTGTCCTCGTTCGGGGTCAGTGGCACCAAC
GCCCATGTAATCGTCGAGCAGGGGCCGGAGGTGGCCCGGCCCGATCAAGTACGCGGGCTG
GAGCCGGTGTCCGCATCGGTGCCGGTGCCGGTGCCGGTGCCGGAGACGCTGCCGGTGGCG
GAATCGGAGCCGGAGCCGGGATCGGAGCTGGAGTCGTTGCCAGCCCCGGGGCTGGAGCCG
TCGCCGCTGCCGGAGTCGGCGCGCGAGCGGTCGATGCCCGTGCCGTGGGTGCTGTCAGGT
GCCGGAGAGGCCGGGCTGAGGGCCCAGGTCGAGCGGTTGGCGTCCTTCATCGACGCCCAT
CCGGGGCTGGATCCCGCGGATGTCGGGTGGACGCTGGTGGCTTCCCGTTCGCTTCAGGCG
CACCGTGCCGTGGTGGTGGGCACGGACCTCGCGGAGCTACGACGTGGGCTGGACACCGTC
TCGACGGACGGCGCCGCCCAGCCCGGTCGCAAGGTGGTGTTTGTCTTCCCCGGGCAGGGG
TCGCAGTGGGTCGGGATGGCGTTGGAACTGCTCGAGTTCTCGCCGGTGTTCGCGCGGCGG
ATGCGCGAATGTGCCGATGCGCTGGCCCCGTTCGTCGAGTGGTCGCTGTTCGATGTGCTG
GGCGATGAGGCGGCGCTCGGGCGGGTTGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATG
GTGTCGTTGGCGGAGTTGTGGCGTTCGTACGGTGTGGTGCCGTCGGCGGTGGTGGGTCAC
TCGCAGGGTGAGATCGCGGCGGCGTGTGTCGCCGGGGGTCTTTCCGTGGAGGATGGGGCG
CGGGTGGTGGCCTTGCGGAGCAAGGCGCTGCTGGCTCTGTCGGGCCGGGGTGGCATGGTG
TCCGTTCCGGTGTCCGCCGACCGGCTCCGCAATCGTCCGGGGCTGTCGGTGGCGGCGGTG
AACGGTCCGGCGTCGACGGTGGTGTCCGGTGCCGTCGAGGTGCTGGACACGGTGCTTGCG
GAGTTCCCGGAGGCCAAACGGATCCCCGTGGACTACGCCTCGCACTCCCCGCAGGTGGCG
GAGATCCAGCGGGAGCTGGCGGACGCGCTGGCGCCGGTCCGGCCGCGCGGTGGACAGGTC
GGGTTCCACTCGACGGTGACCGGACGGCTCATCGACACCTCAGAACTCGACCCCGACTAC
TGGTACCGCAACCTCCGGCACACGGTGGAATTCCAGAGCACCGTCGAAGCCCTGATCCGC
CAGGGCCACACCGTGTTTGTCGAGGTGAGCCCGCATCCGGTGCTGACCGTCGGTATCCAG
GACACCGTCGACACCGCGGTCACCGCCGACACCACCCCCATCGCCGACGCCACGGACGCC
ACGGACGGCACCGGTGGCACCGGTGCCGTCGGCGCCGACATCGTCGTGACCGGATCGCTG
CGCCGCGACGACGGTGGTCCGGTCCGCTTCCTCACCGCCCTCGCCGACCTTTACACCCGA
GGTGTGGACGTGGACTGGCGTCCGGTCTTCACCCGCGCCCGGACGGTGGACCTTCCCACC
TACGCGTTCCAGCGCGAGCGCTTCTGGCTGAAGCCCGCGCGGGCGGTGACCCAGGCGTCC
GGGCTGGGCCTCGGCGATATCGAGCACCCCCTGCTGGGCGCGGTACTGCCGCTGCCCGGG
GCCGAAGGCGGTGTGCTGACCGGACTGCTCTCCCTGGACGGACAGCCCTGGCTGGCCGAC
CACATGGTGCAGGGCACGGTGGTCTTCCCGGGCACGGGATTCGTCGAACTCGCCCTCCAG
GCCGGTCAGCACTTCGGACACCCGGTGGTGGAGGAGCTGACCCTACAGGCTCCGCTGGTG
GTGCCGGGCCAGGGCGGGGTCCAGATACAGGTGGCCGTCTCGACGGCGGACGAGCGGGGC
CGGAGGCCGGTCACCGTGCACTCGTGCCGCGCCGGGGAGTGGGTGCTGCATGCCTCGGGC
ACCCTCGGTGCGATGGGTGATCTCGACGTCACCGAGACGTATCCCACCGAGGTGGCCCGG
TCCCTGGAGGTGTGGCCGCCAGAGGGCGCGCGGCGCGTCGATGTCTCGGGAATGTACGAG
ACGATGGCGGAGCGCGGTTACGGATACGGTCCCGCTTTCCAAGGGCTGCGCGCCGCGTGG
ACACGCGATGACGCGATCTATGCCGAGGTGGCCCTGGAGCCGGAGGCACAGGACGTAGCG
GCGCGGTGCGGTGCGCATCCGGCCCTGCTCGACGCCGCCCTGCACGGAGTGGGGCTCGGC
CGTTTCCTCGCCGACCCCGGTCAGGCGTATCTGCCGTTCTCCTGGAACGGGGTGGTGCTG
CACGCGGTCGGTGCCTCTGCCATCCGCGTGGTGCTCTCCCCGGCCGGTCCGGACGCGGTG
TCACTGGAGGTGGCGGACCCGACGGGCGCTCCGGTGCTGTCGGTGGCGTCGCTCGCGCTG
CGTCCGCTGTCCGGCCGCCGGATCGCGGACACCCGGGGGGTGGATCAGGACTCGCTGTTC
CGCGTGGACTGGGCCGAGACACCGCTGCCCATCGCCACGGCGGGCTCGGCACCGGATGAG
TTCGATGTGTCGGCGAAGTCCGACTCGCCGGTGAAGTTCGATGCCCCGGTCGAGTACGAC
GCCCTCGCCCCGGATGCCCCGGTGCCCCACATCGTGGCACTGACCTGTGAGTCGGCCGGT
GACGCGGTGTCCGCCGTCGTGTGCCGGGTGCTGGCGGTGGTACGGCGGTGGCTCGCCGAC
GAGCGATGTGCCCGGTCGCGGCTGGCCGTGCTGACGCGTGGCGCGGTGGCGACCGCTCCC
GGCGAGAGCGTCGACGACCTCGGCGCGGCGGCCGTCTGGGGCCTGCTCCGCAGCGCACAG
GCCGAACATCCGGACCGCTTCGTCCTCATCGACCACGACGGCCACCAGGATTCCCGCACG
GCCCTGGCCGCCGCGCTGACCGCCGCGGCGGCCGGTGGCCATGCGCATCTCGCGCTGCGC
CGTGGCCGTGCCCTGACGCCTCAGCTCGCTCCGCTCACCCCGTCCGTCACCGCCCCGTCC
GTCACCATCCCGTCCGGCGCCACTCCGCCCGTCACCAACCCATCCGCTGCCACCCCAGCC
CTGGAGGACGGGGTGCCGTGGCGGATGGACGTCACCAGCCAGGGCACGCTGGAGAATCTG
GCCGCCGTCCCCTGCCCGGAAGCAGCCGGTGCCCTCGGCGCCGGACAGGTGAGGGTGGCG
ATGCACGCGGCCGGGGTGAACTTCCGGGACGTCGTGGTCGCCCTCGGCATGATCCCCGGC
CAGGACGTCATCGGCAGCGAGGGCGCCGGAGTGGTGCTCGACATCGGCCCCGGTGTGTCC
GATCTGGCGCCCGGCGACCGGGTGATGGGCCTGTTCTCCGGTGCGTTCGGCCCGGTGGCG
TTGACCGATCACCGGCTGTTGGCGCGGCTGCCGGAGGGCTGGTCGTTCGCCGACGCCGCG
GCCACACCGGTGGTGTTCCTGACCGCCATGTACGGGCTGATGGACCTGGCCGGTCTCCGG
CCCGGAGAATCGGTGCTGGTGCACTCGGCCGCTGGCGGGGTGGGCATGGCCGCCACGCAG
GTGGCCCACTGGCTCGGTGCGGAGGTGTACGCCACCGCGAGCCCCGGGAAGTGGGACACG
CTGCGCGCTGGAGGAGTGGCGGACGACCGGATCGCCTCCTCCCGCTCCTTGGAGTTCGCC
GACCGCTTCGGCCGGGTGGACGTGGTGCTGAACTCGCTGGCGGGCGAGTACGTGGACGCC
TCGCTCGGGCTGCTCGCCGACGGCGGACGTTTCCTGGAGATGGGCAAGACCGACATCCGC
GACGGTGACCGTGTGGCCGCCGTGCACGGGGTGCGGTACCAGGCGTTCGACCTCATGGAC
GCGGGCCCCGACCGGGTCGGTGAACTGCTCCGGCTGCTGGTGTCGCTCTTCGAGCGAGGG
GCCTTCACCGCGCTGCCGACCCGTGCGTGGGATGTACGGCGGGCGGGCGACGCGCTGCGC
TTCCTCTCGCAGGCACGCCACATCGGCAAGCTGGTGTTGTCCATCCCGCGGCCGCTGCGG
GAGGGGGACACCGTGCTCATCACGGGCGGCACCGGCACACTGGGCGGGCTGGTCGCCCGT
CACCTGGTGGAGCGGCACGGGGTACGGGATGTCGTCCTGGCCGGTCGACGGGGGCCGGAC
GCTCCGGGCGCGGCCGAACTCGCCGGCGCCCTGCGGGAACACGGTGCCCAGGTGCGAGTG
GTGGCCTGTGACGTGGCCGACCGGGACGAGCTGGCACGGTTGCTGGACACCATCCCCCGC
CTGCGGATGGTGGTGCACACCGCGGGCGTGCTCGACGACGGGGTGATCGAGTCGCTCACC
CCGGAGCGGGTGCGCGAGGTCCTGCGGCCGAAGGTGGACGCCGCCTGGCATCTGCACGAG
CTGACGGCCGATCGTGAGCTGGCGGAGTTCGTGGTGTTCTCCTCGGCCGCGGGTGTCCTG
GGAAGCCCCGGGCAGGGTGCCTACGCGGCGGCGAACGCTTGGCTGGACGCGCTGATGGCG
CGCCGCCGTGCCGCCGGGCTGCCGGGGCTCTCGGTGGCATGGGGACTGTGGGCCGAGCGC
AGCGGGATGACTGGCCATCTGTCGGACCGCGATCTCGCCCGGATGGCCAGGGCGGGTGCC
ACGCCTCTCGCCACCGAGCAGGGGCTACGGCTCCTCGACAGCGCCAGGGCGGCGACCGAG
GCGGTCGTGCTGGCCACCCCGCTGGACGCCGCGGCGCTGCGGGCACAGGCCGACGCCGGT
GCGCTGCCCGCGCTCTTCCGCGGTCTGGTCCGTGCGCCGATCCGCCGCGCGACCGGCGCG
GGTCCGGTCGAGGACGAGTCCTCGCTGCGGGGCCGGATGGCCGCGATGCCGGCCGCCGAA
CGCCAACAGCTGGTGCTGGACCTGGTCCGTACGCAAGTGGCGACCGTGCTGGGACACGGC
ACCCCCGCCGCGGTCGACACGGCGCGCACCTTCGCGGAGGCCGGCTTCGACTCGCTCACG
GCCGTCGAATTGCGCAACCGGCTGCGCACGACCACCGGGGTCAGGCTGCCGGCCACCGCG
ATCTTCGACTATCCGACACCGGCCGTCCTGGCCGGCCATCTTCTCCGGGAGCTGGACGGC
ACCGCCGACGTGGCCGTGGCGCGGGCCGCCGCCCCGGCTGCCGCCACCGACCGGGACCCG
ATCGTGATCGTCGGGATGGCCTGCCGCTATCCGGGCGGGGTGACCTCGCCCGAGGAGCTG
TGGGAACTGCTCGACACCGGGCGCGACGCGGTTTCGGATCTGCCGGACGACCGCGGCTGG
GACCTGGACGGCCTGTACAGCGCCGATCCGGACAGCTCGGGCACCTCGTACGTCCGCGCC
GGTGGCTTCGTGCACGACGCGGGGGAGTTCGACGCCGACTTCTTCGGCATCTCGCCGCGC
GAGGCGCTCGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAAGTGGCCTGGGAGACGGTG
GAGCGGGCCGGTATCCCGGTGGCGTCGCTGAAGGGAAGCCAGACCGGGGTGTTCGTCGGC
GCCGCCTCACAGGGCTACGGAACGGGGGCCGGGCAGGCCGCGGAGGGCTCCGAGGGCTAC
TTCCTGACCGGTGGCGCGGGCAGTGTGGTCTCCGGCCGGCTCTCGTACACCTTCGGTCTG
GAGGGCCCGGCGGTCACCGTGGACACCGCCTGCTCCTCGTCGCTGGTCGCGTTGCACCTG
GCGGCGCAGGCCCTGCGGTCGGGTGAGTGTTCGCTGGCACTGGCCGGCGGGGTGACGGTG
ATGGCGACCCCGGGCATCTTCGTGGAGTTCTCCCGCCAGCGCGGACTGGCCGCCGATGGC
CGCTGCAAGGCGTTCGCCGACGCGGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCATG
CTGCTGCTGGAGCGGCTGTCCGACGCGCGCCGCAACGACCACCGGGTCCTGGCGGTCGTA
CGGGGCTCCGCCGTCAACCAGGACGGCGCTTCGAACGGCCTGACCGCGCCCAACGGGCCC
TCGCAGCAGCGGGTGGTCCGGGCCGCGCTGGCGAACGCCGGGCTGGCCGCGTCGGAGGTG
GACGCGGTGGAGGCACACGGCACCGGCACCAGCCTGGGCGACCCGATCGAGGCACAGGCA
CTGCTGGCCACCTACGGGCAGGAGCGCGAACGGCCGCTGCTGCTGGGCTCGATCAAGTCG
AACATCGGGCACACCCAGTCGGCCGCGGGAGTGGCCGGGGTCATCAAGATGGTGCTGGCG
ATGCGGCACGGAACGCTGCCCCGGACCCTGCATGTGGACGAGCCGTCGACCCATGTGGAC
TGGTCGGCCGGTGCGGTGGAGCTGCTGACCCGGCCCGCTGAGTGGCCGGGGACCTCCCGC
CCCCGCCGGGCCGGGGTGTCCTCGTTCGGGGTGAGCGGGACCAACGCCCATGTGATCCTC
GAACAGTCACCCACCGAGTCCGGTACCGACCCGCGGCAGGCACCCGAGCGGGCCCCGGCG
GTGGTGCCATGGGTGCTGTCCGGCCAGGGCGAGCGCGGACTGCGGGCGCAGGCCGAGCGG
TTGCGGTCCTTCCTGGCCGCGCACCCCGAGTCGGGCCCGGCCGATGTGGGCTGGTCGCTG
GCCGCCACCCGTTCGGCGCTCTCGCACCGGGCCGCGGTGGTCGGGGCCGACCGGGCGGAG
CTGCTGGACGGACTGGCCGCGCTGGCGGCCGGCGAGCCCGCGCCGGGCGTGGCCCTGGGC
ACCGCGGGGCCGGGCCGGGTGGGCGTGCTGTTCGCGGGCCAGGGTACTCAACGGGCCGGT
ATGGGACGTGAGTTGTACCAGGCGTTCCCGGTGTTCGCGGCGGCGTGGGACGAGGTGTGC
GCCGCGCTCGACCCACATCTGGACCGTCCGCTCGGCGAGGTGGTGACCGACACCACCGGC
GAGCTGGACACCACCGGCGCGTTGGATGCCACCGCGTATGCGCAGGCGGGCCTGTTCGCC
CTCGAAGTGTCGCTGTTCCGGCTGGTGTCCTCCTGGGGGGTGCGGCCGGACTATCTGCTG
GGACACTCCATCGGCGAGCTGGCCGCCGCCTATGTGGCCGGGGTGTGGTCGCTGGAGGAC
GCCGCCAAGGTGGTGGCGGCCCGGGGTCGGCTCATGGGCGCGCTGCCGCCGGGCGGGGCG
ATGGTGGCCCTGGCCGCGCCGGAAGACCAGGTACGGCCGTTCCTGACCGACCGGATCGCC
CTCGCGGCCGTGAACGGGCCGTCGTCGGTCGTGGTGTCCGGGGACGAGGACGCGGTGCGC
GGTGTGGCCGAGGCGTTCGCCGCCCGTGGGGTGAAGACGCGGCGGCTGCGAGTGAGCCAC
GCCTTCCACTCACCGCAGATGGACGGAATGCTCATCGCGTTCGGCGAGGTACTCGGCACG
GTGGACTTCCGTACCCCGCGAATACCGGTGGTGTCGAACCTCTCCGGCGCGGTGGCCGGG
GAGGAACTGTGCTTCCCCGCCTACTGGGTGCGGCAGGTGCGGGAGACGGTGCGGTTCGCC
GCCGGGCTGGAGCGGCTGCGAGAGCTCGGCACGGACACCTTCCTCGAACTCGGGCCGGAC
GGCACCTTCACCGCCTTGGCCCAGGCCCAGGTCACCGGGGCGGACGCCGAGTTCATCCCC
ACCCTGCGCGCCGACCGGCCCGAGCCGGTCACGGTCACCACCGCCCTCGCCCAGTTGTAC
ACGCACGGTGTGGAGCCGGACTGGTCCGCGGCCTTCCCCGGCGCCCGCCGGACCGAGCTG
CCGACCTACGCCTTCCAGCGCTCCCGCTTCTGGCTGGAGCCCTCCCGTACACCGGGCGAC
GCGGCCGGCTTCGGGCTCGGCGCGCTGGACCATCCACTGGTCGGTGCGAGGGTGCCGCTG
CCCGACGCGGACGGTGTCCTGCTCACCGGCCGCGTCTCCGCCGACGCCCACCCGTGGCTG
ACCGGCCGGCGAGTGCTGGGCGTGCCCCTGTTCCCGGCGACCGGCTTCCTGGAACTGGTG
CTCCAGGCGGGGCTCCAGTACGACTGCCGGACGGTGGACGAACTCACCATCCATGAACCA
CTCGTCCTCCCCGAGCGGGGCGCGGTCGAGGTGCAGGTGTCCGTCCGTGGCGCCGACGAG
TCCGGCCGCCGTCCGGTCACCGTGTACTGCCGCCGCGACCAGCGGTGGGTCCGGTATGCC
ACGGCCGTCCTCGGTGCGGACCGGCCGCCCGCGCCGGAGCACCCCGAGACCTGGCCGCCC
ACCGGCGCCCGGCCGCTGGAGTCCGGCGGGACACCGGCGTGGCGCCGTGGCGACGAGGTC
TTCCTGGACATCGAGCTGCCCGAGGTGGCCGGGGCCGGACGCTGGACGCTGCATCCCGCC
CTGCTCGACCAGGCGTTGCGCGGGGAGGCGCTGGCAGGGCTGGTCACCGCGCCCGAGGGG
GCCCATCTGCCGTTCTCCTGGACGGGGATCACCCTGCACACCACGGGTGCCACGAGGCTG
CGGGTCACCCTCGCGCCCGTCGGCCCGGACACGGTCTCGCTCCAGGTGGCCGACGCCGCC
GGAACACCCGTGCTGTCGGTGGACTCGCTGGTGCTCCGCCCGGTGTCCGGACAGCGGCTG
CGCCAGGCCAACGCGGCACTGTTCCGGCCGGTGTGGGCCGCTTGCCGTACGCGTCCCGAA
CCGGACACCGGCACCGTCCGGTGGGCGCTCGTCGGCGACCCGGACGCCTGGAAAGACGCC
TGGAAAGACGCCTGGAAAGACGCCTGGAAAGACGCCTGGAAAGACGCCTGGGAAGACGTG
TGGGAAGACGCCTGGGAACCGGACATGTTCGGCGCGCCGGTCGCGGTGTATCCGGACCTG
TCGACCATCGAGGACGTGCCGGACATCGTCCTCCTCCCGTGTGTATCCGAGGGTGGGACG
GCCTCCGAGGTGGCCGTCCGGGTATCCGAGGCCGTGCGGACGTGGCTGGCCGGGGAGCGG
TTCGCCACCTCGCGTCTGGTGCTGGTGACCCGGGGCGCGCTCGCCACGGCGGCCGGTGAG
GATGTCGAGGACCTGGCCGCGGCCGCGGTGTGGTCGCTGGTGGAGCCCCTCCAGGCGGCC
GAGGCGGGACGGCTGACACTCGTCGACACCGATAGGTGGGATCTGCGCACGCTGCGCGCC
GCGGTGGCCGTGGAGGAGGACCGGGTCGCAGTCCGGACGGGAGCGGTGCTGGTACCGGAC
CTGGCCACGGCGGTAGCCACCGAGCAGGATCCGCCCGCCTGGGGCCCGGGGACGGTGCTG
GTCACCGGCGGGTCGGCCGCGGCCGTCGCCCGGCATCTGATCGCCGAACACGGTGTGCGC
GACCTGGTCCTGGCCGGGGACGGCGATGTGGCCGAACTGGCGGCACTCGGAGCCACGGTT
CGGCTCGCCCCGTGCGATCCGGCGGACGATCAGGCGCTGGCTGAGCTGCTGGCGGAGATT
CCCGGACTGCGGAGCGTGGTGCACACCACGGCCGACGCCCCGGAGCGGACCCGGGCCGGC
GCGCTCTCCCCGGAAACCCTGCGGCCACAGCTGCGGTCGGGGGTAGCGGCGGCCTGGAAC
CTGCACCTGGCCACGCGGGGCCTGGAACTGGACCGCTTTGTGCTGTTCACCTCCGGCGCC
GGGACACTGGGCTCCGCGTACGCCGACGCGCTGGCCGCACACCGGCGGGCTCTCGGGCTG
CCCGCGGTGTCCGTCTCCACCGACCTGGGCCTCGCCCTGTTCCACGAGGCATGCGCCGGA
CCCGGGGAGGCGGTCCGGGTCACCACCGCCACGCCGGTCCCCGCACGCACCGAAGCGGTC
AGGCAGCCGGTGGAACAAGCCCCGGCGGCCGAGGCTTCCGCGACCACGCTGCTGGAGCGG
CTGGCCGGGCGGACGGAGGACGAGCAGGACGAGATCTTGCTGGAGCTGGTCCGTGGCCAG
GTCGCCATGGTGCTCGGCCATCCGGACGCCACCATGGTCGACCCGGACCGAGGCTTCGTG
GACATGGGCTTCGACTCGGTGGCGGCCGTGAAGCTCCGCAACCAACTGGCCGGGGCCACC
CGGCTCGACCTGCCCGCCAGCCTCACCTTCGACCACCCCACTGCCGTCGATCTCGCCCGC
CATCTGCGTGCCGAAATGCTGCCCGATGACGCGGCGGCCGCCATTCTCGTGCTCGAAGAG
CTCAACAAGCTCGACGATTCGATCCTCGTGCTCGACCCGGGAAGCGCGGCACGGGTGCGG
ATCTCGACCCTGCTCCAGGATCTGGCCGCGAAATGGGTCGAGCGGGCGGATCCGCACGCC
CTGAGCGAGTACGTCGAGCGCAGCGCGGAGACGCTGATCGACGCCTTCGCCTCCCGAGGC
GAGGCCGAGCTGATCACCGAGTACGCGTCGGTGATCCCGCTGCTGGTCTTCAACCAGCTG
TTCGGGGCGCGTCCGGCGGACGGGCCGAAGCTGGTCGAGACGATGATGAAGCTCTTCGAC
AGCGGCGAGGACGCGGCGGCGGCCAACGACGAACTGCTCCACTGGATCTCCGGCCTGCTG
GCGGAAAAGCGCCGGCAGCCCGCCGCGGATGTCACCTCCTGGCTGATGGCGCACCCCTCG
CAGCTCGCCGACGACGAGCTGATGCAGCAGATGATCCTGCTGATGGCGGCCGGTACCGAC
CCCGAGCAGAACCTGATCGCCAACGCGCTGCGCCTGCTGCTGTCGGACGACCGCTTCGCC
GGTGAGCTGTCCGGTGGCAGCATGCCCGTCGAGGACGCCCTGGACGAGGTCCTGTGGAAC
GATCCGCCGATGGCCAACTACGGCACCCGGTTCCCCCGTTACGACTGCGATGTGGCGGGC
GTACGGCTGCGCAAGGGCGACCCGGTGCTCATCAGCTACGCCGCGGCCAACCACGAGGCC
GCCCTGGCCTCCGACCGCCGGTCCGGCAACCGGGCCCATCTGGCCTGGAGCGCGGGCGCC
CATCGCTGCCCCGCCGAGCGGCCCGCCCGGGTGATCGCCTCGGTGGCCATCGAGCGGCTC
CTGGACCGCCTCCCGGACATGGAACTGGCCGTCCCCGCGGAGCGGTTGACGTGGCGGACC
GGGCCCTTCTCGCGCGCCCTGGCCACTCTGCCGGTGCGCTTCCCCGCCCAAGCGACATCC
AGGACCGGGCCGTCCGCAGCGTCGGTGTCCGAGTCGACCCGATTCGACGAGACCTCTGGA
GGCAGCCAATGGAACCCCGTCCCATCGTTCTCGACCCCGCCGGCCGCGACATCCCCGGAG
AGGCAGCCCGAGTCGCAGCAGGCGGCGAGGCGACGCTTGTTGAGCTTCCTGACGGCGTGG
TGGCGTGGGCAATAA
[8] KS50..426
[8] AT572..842
[8] malonyl-CoA757..761
[8] KR1145..1321
[8] ACP1415..1485
[9] KS1508..1879
[9] AT2023..2292
[9] malonyl-CoA2208..2212
[9] KR2595..2771
[9] ACP2857..2927
[10] KS2950..3319
[10] AT3471..3780
[10] methylmalonyl-CoA3650..3654
[10] KR4110..4286
[10] ACP4392..4462
[11] KS4485..4862
[11] AT5007..5275
[11] malonyl-CoA5192..5196
[11] KR5581..5757
[11] ACP5852..5922
[12] KS5944..6320
[12] AT6466..6718
[12] malonyl-CoA6634..6638
[12] KR7064..7237
[12] ACP7330..7400
[13] KS7421..7798
[13] AT7993..8324
[13] methylmalonyl-CoA8172..8176
[13] DH8369..8536
[13] ER8875..9173
[13] KR9183..9360
[13] ACP9465..9535
[14] KS9559..9933
[14] AT10090..10406
[14] malonyl-CoA10280..10284
[14] dh10451..10597
[14] kr10917..11072
[14] ACP11133..11203
[8] KS148..1278
[8] AT1714..2526
[8] malonyl-CoA2269..2283
[8] KR3433..3963
[8] ACP4243..4455
[9] KS4522..5637
[9] AT6067..6876
[9] malonyl-CoA6622..6636
[9] KR7783..8313
[9] ACP8569..8781
[10] KS8848..9957
[10] AT10411..11340
[10] methylmalonyl-CoA10948..10962
[10] KR12328..12858
[10] ACP13174..13386
[11] KS13453..14586
[11] AT15019..15825
[11] malonyl-CoA15574..15588
[11] KR16741..17271
[11] ACP17554..17766
[12] KS17830..18960
[12] AT19396..20154
[12] malonyl-CoA19900..19914
[12] KR21190..21711
[12] ACP21988..22200
[13] KS22261..23394
[13] AT23977..24972
[13] methylmalonyl-CoA24514..24528
[13] DH25105..25608
[13] ER26623..27519
[13] KR27547..28080
[13] ACP28393..28605
[14] KS28675..29799
[14] AT30268..31218
[14] malonyl-CoA30838..30852
[14] dh31351..31791
[14] kr32749..33216
[14] ACP33397..33609

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11259-11534]  2.60000517657733e-44 SSF48264
SSF48264   Cytochrome_P450
 [11243-11534]  3.09999999999998e-47 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR001227 Acyl transferase domain (Domain)
 [571-689]  G3DSA:3.40.366.10 [756-845]  G3DSA:3.40.366.10 [2022-2140]  G3DSA:3.40.366.10 [2207-2296]  G3DSA:3.40.366.10 [3463-3591]  G3DSA:3.40.366.10 [3650-3770]  G3DSA:3.40.366.10 [5006-5124]  G3DSA:3.40.366.10 [5191-5281]  G3DSA:3.40.366.10 [6465-6583]  G3DSA:3.40.366.10 [6631-6722]  G3DSA:3.40.366.10 [7983-8113]  G3DSA:3.40.366.10 [8172-8313]  G3DSA:3.40.366.10 [10087-10212]  G3DSA:3.40.366.10 [10279-10386]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [7064-7224]  1.2e-59 PF00106 [9184-9347]  2.50000000000001e-63 PF00106
PF00106   adh_short
IPR002397 Cytochrome P450, B-class (Family)
 [11283-11299]  8.60000664726925e-10 PR00359 [11334-11356]  8.60000664726925e-10 PR00359 [11430-11457]  8.60000664726925e-10 PR00359
PR00359   BP450
IPR006162 Phosphopantetheine attachment site (PTM)
 [1443-1458]  PS00012 [2885-2900]  PS00012 [5880-5895]  PS00012 [7358-7373]  PS00012 [9493-9508]  PS00012 [11161-11176]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1413-1485]  G3DSA:1.10.1200.10 [2856-2930]  G3DSA:1.10.1200.10 [4390-4465]  G3DSA:1.10.1200.10 [5851-5922]  G3DSA:1.10.1200.10 [7329-7401]  G3DSA:1.10.1200.10 [9462-9539]  G3DSA:1.10.1200.10 [11133-11206]  G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1419-1484]  6.60000000000002e-12 PF00550 [2861-2926]  1.5e-07 PF00550 [4396-4460]  5e-09 PF00550 [5855-5921]  1.9e-13 PF00550 [7333-7399]  4.9e-13 PF00550 [9468-9534]  5.90000000000001e-11 PF00550 [11137-11202]  1e-09 PF00550
PF00550   PP-binding
 [1415-1485]  PS50075 [2857-2927]  PS50075 [4392-4462]  PS50075 [5852-5922]  PS50075 [7330-7400]  PS50075 [9465-9535]  PS50075 [11133-11203]  PS50075
PS50075   ACP_DOMAIN
 [1408-1524]  1.50000306971104e-26 SSF47336 [2850-2966]  2.70000183580794e-26 SSF47336 [4385-4501]  3.69999438558106e-25 SSF47336 [5845-5960]  2.30000440726534e-27 SSF47336 [7323-7438]  7.30000590915208e-29 SSF47336 [9458-9575]  5.69999708783953e-29 SSF47336 [11124-11210]  1.20000117458134e-19 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [8869-9020]  1.79999754022375e-30 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [8895-8950]  1.8e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1145-1320]  5.59999999999999e-57 PF08659 [2595-2770]  2.89999999999999e-53 PF08659 [4110-4285]  8.1e-61 PF08659 [5581-5756]  2.80000000000001e-57 PF08659 [10917-11066]  1.4e-21 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [50-300]  4.59999999999996e-99 PF00109 [1508-1753]  1e-91 PF00109 [2950-3193]  6.7999999999999e-90 PF00109 [4485-4736]  7.30000000000007e-96 PF00109 [5944-6194]  1.79999999999997e-96 PF00109 [7421-7672]  7.30000000000007e-100 PF00109 [9559-9809]  2.70000000000002e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [308-426]  1.99999999999999e-49 PF02801 [1761-1879]  7.5e-49 PF02801 [3201-3319]  2.89999999999999e-48 PF02801 [4744-4862]  1.29999999999998e-48 PF02801 [6202-6320]  1.2e-49 PF02801 [7680-7798]  1.09999999999999e-49 PF02801 [9817-9933]  8.89999999999994e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-842]  4.6e-54 PF00698 [2023-2292]  1.29999999999998e-57 PF00698 [3471-3780]  5.59999999999999e-96 PF00698 [5007-5275]  1.70000000000001e-53 PF00698 [6466-6718]  5.49999999999995e-42 PF00698 [7993-8324]  3.30000000000002e-94 PF00698 [10090-10406]  6.49999999999992e-69 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [17-43]  4.80000000000001e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-871]  1.19999063421924e-66 SSF52151 [2020-2322]  1.09999184471405e-67 SSF52151 [3469-3775]  1.39999277195148e-66 SSF52151 [5004-5306]  1.39999277195148e-69 SSF52151 [6463-6748]  1.19999063421924e-68 SSF52151 [7991-8265]  5.29997329885557e-67 SSF52151 [10086-10400]  6.90004508941104e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-756]  1.50000306971104e-17 SSF55048 [2145-2207]  2.19999900980708e-17 SSF55048 [3593-3649]  2.79999889404114e-10 SSF55048 [5129-5191]  1.20000117458134e-13 SSF55048 [8115-8171]  2.59999946718995e-10 SSF55048 [10217-10279]  3.0999994589937e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [52-312]  G3DSA:3.40.47.10 [313-478]  G3DSA:3.40.47.10 [1510-1765]  G3DSA:3.40.47.10 [1766-1930]  G3DSA:3.40.47.10 [2949-3204]  G3DSA:3.40.47.10 [3205-3369]  G3DSA:3.40.47.10 [4487-4748]  G3DSA:3.40.47.10 [4749-4914]  G3DSA:3.40.47.10 [5944-6205]  G3DSA:3.40.47.10 [6206-6372]  G3DSA:3.40.47.10 [7421-7683]  G3DSA:3.40.47.10 [7684-7850]  G3DSA:3.40.47.10 [9561-9821]  G3DSA:3.40.47.10 [9822-9985]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [42-424]  3.30001976117415e-104 SSF53901 [1500-1877]  2.59998233910302e-101 SSF53901 [2942-3317]  4.80002938964646e-103 SSF53901 [4484-4914]  1.90000694315261e-103 SSF53901 [5936-6372]  3.99998544139406e-103 SSF53901 [7414-7796]  2.39999798157263e-107 SSF53901 [9551-9931]  8.70005082121738e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1145-1323]  G3DSA:3.40.50.720 [2595-2777]  G3DSA:3.40.50.720 [4111-4292]  G3DSA:3.40.50.720 [5582-5759]  G3DSA:3.40.50.720 [7065-7243]  G3DSA:3.40.50.720 [8966-9147]  4.30000000000003e-41 G3DSA:3.40.50.720 [9181-9367]  G3DSA:3.40.50.720 [10918-11124]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [213-229]  PS00606 [1666-1682]  PS00606 [3106-3122]  PS00606 [4649-4665]  PS00606 [6107-6123]  PS00606 [7585-7601]  PS00606 [9722-9738]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-856]  2.2999842048857e-115 SM00827 [2023-2307]  2.39999798157263e-119 SM00827 [3473-3761]  7.0999832511256e-111 SM00827 [5007-5291]  6.80004680300024e-111 SM00827 [6466-6733]  5.50001754266469e-96 SM00827 [7995-8304]  1.69998802370953e-113 SM00827 [10090-10386]  3.39999972437719e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1416-1488]  1.49999648196323e-34 SM00823 [2858-2930]  1.29999924468179e-29 SM00823 [4393-4465]  4.10001399699315e-34 SM00823 [5853-5925]  3.0999994589937e-31 SM00823 [7331-7403]  1.90000694315261e-36 SM00823 [9466-9538]  1.99999636034521e-35 SM00823 [11134-11206]  6.69999687625999e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [8369-8536]  3.79997359309398e-79 SM00826 [10451-10597]  4.69998262513195e-55 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [52-478]  SM00825 [1510-1931]  SM00825 [2952-3370]  SM00825 [4487-4914]  SM00825 [5946-6372]  SM00825 [7424-7850]  SM00825 [9561-9985]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1145-1321]  5.20000089003336e-46 SM00822 [2595-2771]  6.00001679190159e-47 SM00822 [4110-4286]  2.1000026783403e-55 SM00822 [5581-5757]  5.09998762524166e-47 SM00822 [7064-7237]  3.49999466863949e-55 SM00822 [9183-9360]  2.1000026783403e-58 SM00822 [10917-11072]  7.80000016938413e-14 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [8875-9173]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit