close all open/close all
Merid_00040 Merid_00040   last last

CDS information : Merid_00050


close this sectionLocation

Organism
StrainDSM 4137
Entry nameMeridamycin
Contig
Start / Stop / Direction86,051 / 87,277 / + [in whole cluster]
86,051 / 87,277 / + [in contig]
Location86051..87277 [in whole cluster]
86051..87277 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)MerD
Gene
Gene (GenBank)merD
EC number
Keyword
  • C-9
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • putative P450 hydroxylase
Reference
ACC
PmId
[17159202] Organization of the biosynthetic gene cluster in Streptomyces sp. DSM 4137 for the novel neuroprotectant polyketide meridamycin. (Microbiology. , 2006)
Related Reference
ACC
P33271
PmId
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative cytochrome P450 [MerD]
MEPRPIVLDPAGRDIPGEAARVAAGGEATLVELPDGVVAWAISRQRTLKQLLTDPRVSKD
PRQHWPAWINGEISPEWPLITWVAVENMFTSYGGDHRRLRTLVSKAFTARRTAALRPRIE
EICATLLDGLATAAPGEPVDLREAYAYPLPIQVISELFGLDDENLRERMRRVVDSIFHTS
ATPEEVTATYTEMYAVLGELVATKRERPGDDLTSGLIAVRDEESGSALSEKELTDTLALF
LSAGHETTVNLLDNAIHALLTRPEQLDHVRAGRATWDDVIEETLRHSAPVANLPLRYAVE
DIELDGGVVLRKGDAILAAYAAAGRDPEVHGEDADHFDVTRGLKNHLAFGHGVHLCVGAP
LGRLEAAIALPALFDRFPGLKLASGQDPLEPVESFISNGHRTLPARLS
selected fasta
>putative cytochrome P450 [MerD]
ATGGAACCCCGTCCCATCGTTCTCGACCCCGCCGGCCGCGACATCCCCGGAGAGGCAGCC
CGAGTCGCAGCAGGCGGCGAGGCGACGCTTGTTGAGCTTCCTGACGGCGTGGTGGCGTGG
GCAATAAGCCGCCAGCGGACACTCAAACAGCTGCTGACCGACCCCCGGGTCTCCAAGGAC
CCCCGGCAGCACTGGCCGGCGTGGATCAACGGTGAGATCTCGCCCGAGTGGCCGCTGATC
ACCTGGGTCGCCGTCGAGAACATGTTCACCTCCTACGGCGGTGACCACCGGCGGCTGCGC
ACCCTGGTCTCCAAGGCGTTCACCGCCCGGCGCACCGCCGCCCTGCGGCCGCGCATCGAG
GAGATCTGCGCCACCCTCCTGGACGGGCTGGCCACCGCCGCGCCGGGCGAGCCGGTCGAC
CTGCGCGAGGCGTACGCGTATCCGCTGCCGATCCAGGTGATCTCCGAGCTGTTCGGGCTC
GACGACGAGAATCTGCGCGAGCGGATGCGCCGGGTCGTGGACTCCATCTTCCACACCTCC
GCCACGCCGGAGGAGGTCACCGCCACCTACACCGAGATGTACGCCGTACTCGGCGAGCTG
GTGGCCACCAAGCGCGAGCGCCCCGGCGACGACCTGACCAGCGGGCTGATCGCGGTGCGG
GACGAGGAGAGCGGCTCCGCGCTCAGCGAGAAGGAGCTGACCGACACCCTCGCGCTGTTC
CTCTCGGCCGGTCACGAGACCACGGTCAACCTCCTGGACAACGCCATCCACGCGCTGCTC
ACCCGGCCCGAGCAGCTCGACCACGTCCGGGCCGGCCGGGCCACCTGGGACGATGTGATC
GAGGAGACGCTGCGGCACTCCGCCCCGGTCGCCAACCTGCCGCTGCGCTACGCGGTGGAG
GACATCGAACTGGACGGCGGCGTGGTGCTGCGCAAGGGTGACGCGATCCTGGCCGCCTAC
GCGGCAGCCGGACGCGACCCCGAGGTGCACGGCGAGGACGCGGACCACTTCGATGTGACC
CGCGGGCTCAAGAACCACCTGGCGTTCGGCCACGGCGTCCATCTGTGCGTCGGCGCCCCG
CTGGGCCGGCTGGAGGCCGCGATCGCGCTCCCGGCCCTCTTCGACCGCTTCCCCGGGCTC
AAGCTGGCGTCCGGGCAGGATCCGCTGGAGCCGGTGGAGTCCTTCATCTCCAACGGTCAC
CGCACCTTGCCCGCACGGCTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [210-270]  2.9e-05 PF00067 [277-391]  7.8e-16 PF00067
PF00067   p450
 [3-407]  5.5e-90 SSF48264
SSF48264   Cytochrome P450
 [243-260]  4.6e-05 PR00385 [278-289]  4.6e-05 PR00385 [347-356]  4.6e-05 PR00385 [356-367]  4.6e-05 PR00385
PR00385   P450
 [14-407]  2.5e-99 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  1.3e-28 PR00359 [140-156]  1.3e-28 PR00359 [195-217]  1.3e-28 PR00359 [278-289]  1.3e-28 PR00359 [296-323]  1.3e-28 PR00359 [347-356]  1.3e-28 PR00359 [356-367]  1.3e-28 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [349-358]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit
Merid_00040 Merid_00040   last last