close all open/close all
first first   Mith_00020 Mith_00020

CDS information : Mith_00010


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction1,462 / 218 / - [in whole cluster]
1,462 / 218 / - [in contig]
Locationcomplement(218..1462) [in whole cluster]
complement(218..1462) [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative major facilitator superfamily transporter
Product (GenBank)membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in mithramycin biosynthesis.
Note (GenBank)
  • ORFA
Reference
ACC
PmId
[9882681] The mithramycin gene cluster of Streptomyces argillaceus contains a positive regulatory gene and two repeated DNA sequences that are located at both ends of the cluster. (J Bacteriol. , 1999)
Related Reference
ACC
P76350
PmId
[9524262] Cloning and analysis of the shiA gene, which encodes the shikimate transport system of escherichia coli K-12. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [membrane protein]
MPIPARPHRTRGSGAHGLRNHRSPTPRQPQAHRRRQPHRHHHRVVRLLPVRSAAALVFNK
LFFPGSDPLVGTLLSFLTYAVGFAARPLGALVFGHYGDRLGRKKLLVLSLVMMGGATFAI
GLLPTHATIGTAAPVLLTVLRLVQGFALGGEWAGPSCWVSEHGDARRRGFWASWPQTGAP
AGQLLATGVLSSSPPCCRTPLGSWGWRIPFLLSGLLVIVGLWIRLSVDESPVFKEALAHA
EARKATEAPQPRSFRSSPVLRHHWRDVLVAMGARMAENISYYVITAFILVYATTSGGVSR
QTALNGVLIASAVHFAVIPAWGALSDRVGPRPVYLLGAVGIGLWMFPFFSLIDTGGFGNL
VLAVTPGLVLHGAMYAPQGAFFSEMFATRMRYCGAFQGAQVASWSRARAPGPRS
selected fasta
>putative major facilitator superfamily transporter [membrane protein]
GTGCCGATACCTGCCCGTCCCCACCGCACACGAGGAAGTGGCGCACATGGCCTCCGGAAC
CACCGCTCCCCCACCCCCCGCCAGCCTCAAGCGCATCGTCGCCGCCAGCCTCATCGGCAC
CACCATCGAGTGGTACGACTTCTTCCTGTACGCTCCGCCGCCGCGCTCGTCTTCAACAAG
CTGTTCTTCCCGGGCTCCGATCCTCTCGTCGGCACGCTGCTGTCCTTCCTGACGTACGCG
GTGGGATTCGCGGCGCGTCCCCTCGGGGCGCTGGTCTTCGGGCACTACGGGGACCGGCTC
GGGCGCAAGAAGCTGCTGGTGCTCAGTCTGGTGATGATGGGCGGGGCGACCTTCGCGATC
GGACTGCTGCCCACGCACGCGACCATCGGGACCGCCGCTCCGGTGCTGCTGACCGTGCTG
CGTCTGGTGCAGGGCTTCGCGCTCGGCGGCGAGTGGGCGGGGCCGTCCTGCTGGGTGTCC
GAGCACGGGGACGCGCGGCGGCGCGGGTTCTGGGCCTCGTGGCCGCAGACCGGTGCGCCG
GCGGGGCAGCTGCTCGCGACCGGCGTGCTCTCCTCCTCACCGCCGTGCTGTCGGACGCCG
CTCGGCAGCTGGGGCTGGCGGATACCGTTCCTGCTCTCCGGCCTGCTGGTGATCGTCGGT
CTGTGGATTCGTCTCTCCGTCGATGAATCGCCGGTGTTCAAGGAGGCGTTGGCGCACGCC
GAGGCCCGGAAGGCGACGGAGGCGCCGCAGCCGAGAAGCTTCCGCTCGTCGCCCGTGCTG
CGGCACCACTGGCGTGACGTGCTCGTCGCGATGGGCGCGCGCATGGCGGAGAACATCTCC
TACTACGTCATCACCGCCTTCATCCTCGTATACGCGACGACTTCGGGCGGTGTCTCCCGC
CAGACCGCCCTCAACGGCGTGCTCATCGCCTCCGCCGTGCACTTCGCGGTGATCCCGGCC
TGGGGCGCGCTCTCCGACCGGGTGGGCCCGCGGCCCGTCTACCTGCTGGGCGCGGTCGGC
ATCGGGCTGTGGATGTTCCCCTTCTTCTCGCTCATCGACACGGGCGGCTTCGGCAACCTC
GTGCTCGCCGTGACCCCCGGGCTGGTGCTGCACGGCGCGATGTACGCACCCCAGGGCGCC
TTCTTCTCCGAGATGTTCGCGACCCGGATGCGCTACTGCGGTGCGTTCCAGGGTGCCCAG
GTCGCCTCCTGGTCGCGGGCGCGTGCTCCTGGGCCCCGCTCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [74-403]  8.80000000000003e-24 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [19-391]  1.90000694315261e-48 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [1-414]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [70-92]  Transmembrane (o-i) [105-127]  Transmembrane (i-o) [204-226]  Transmembrane (o-i) [279-298]  Transmembrane (i-o) [303-325]  Transmembrane (o-i) [332-351]  Transmembrane (i-o) [361-383]  Transmembrane (o-i)
Transmembrane 7   
first first   Mith_00020 Mith_00020