close all open/close all

CDS information : Mith_00020


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction3,416 / 4,246 / + [in whole cluster]
3,416 / 4,246 / + [in contig]
Location3416..4246 [in whole cluster]
3416..4246 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)mithramycin regulator MtmR
Gene
Gene (GenBank)mtmR
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[9882681] The mithramycin gene cluster of Streptomyces argillaceus contains a positive regulatory gene and two repeated DNA sequences that are located at both ends of the cluster. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>transcriptional activator [mithramycin regulator MtmR]
MSVLGPLRLSVNGVDVTPTAPKQMQVLALMALNEGQVVTASSFVDELWAECPPRSAKTTL
QTYILHLRKLISKAFKDESPVVRDILLTRQGGYLLRLPMAPFDLRQFNEFSTEGRIALSQ
GDPFRGSQLLRKALSFWQGPALVDVPTGSILGPKVRGLQAEHQIALECRIEADLQMGRYD
DAIGDLVTLTAQQPLNENIHDQYMRALHLAGRRSEALGIFHRLRKNLMDDLGLEPSEQVQ
RTQQVILSSASSREDGAARNWWTPWAPDRHHGPSAA
selected fasta
>transcriptional activator [mithramycin regulator MtmR]
ATGTCTGTCCTCGGCCCGTTACGGCTCAGTGTCAACGGCGTCGACGTCACTCCTACCGCG
CCGAAGCAGATGCAGGTTCTCGCGCTCATGGCGCTCAATGAAGGGCAGGTGGTGACGGCG
TCGAGCTTTGTGGACGAGCTGTGGGCGGAGTGTCCACCGCGCAGCGCGAAAACAACCCTG
CAAACGTATATCCTGCATCTTCGAAAGCTCATATCGAAGGCTTTCAAAGACGAGTCGCCA
GTGGTCCGGGATATTCTGCTGACCCGGCAGGGCGGCTATCTCCTGCGGCTGCCCATGGCG
CCCTTCGACCTTCGTCAGTTCAATGAATTCTCGACGGAGGGGAGAATTGCACTTTCTCAG
GGGGATCCGTTCCGGGGATCCCAGTTGCTGCGTAAGGCATTGAGCTTCTGGCAGGGGCCT
GCTTTGGTGGACGTGCCGACCGGATCTATTCTCGGGCCGAAGGTGAGGGGGCTTCAGGCG
GAGCATCAGATCGCACTGGAATGCCGTATCGAAGCCGACCTGCAGATGGGCAGGTACGAC
GACGCCATAGGCGACTTGGTCACGCTGACCGCCCAGCAGCCGCTCAACGAGAACATCCAC
GATCAATACATGCGGGCGCTCCACCTAGCCGGACGCCGATCGGAGGCTCTCGGCATCTTC
CACCGACTCCGGAAGAATTTAATGGACGATCTCGGCCTGGAGCCGTCCGAGCAGGTGCAG
CGCACGCAGCAGGTGATCCTCAGCTCGGCGTCGTCGCGAGAGGACGGCGCCGCCCGGAAC
TGGTGGACCCCCTGGGCGCCGGACCGACATCACGGGCCGAGCGCGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [13-95]  6.29999562859499e-10 SM00862
SM00862   Trans_reg_C
 [17-95]  1e-16 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [102-247]  2.1e-40 PF03704
PF03704   BTAD
 [102-247]  1.20000117458134e-39 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [112-224]  2.5e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [19-98]  1.9e-09 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-96]  5.69999708783953e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit