close all open/close all

CDS information : Mith_00030


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction4,347 / 5,129 / + [in whole cluster]
4,347 / 5,129 / + [in contig]
Location4347..5129 [in whole cluster]
4347..5129 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative thioesterase
Gene
Gene (GenBank)mtmZ
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[9882681] The mithramycin gene cluster of Streptomyces argillaceus contains a positive regulatory gene and two repeated DNA sequences that are located at both ends of the cluster. (J Bacteriol. , 1999)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative thioesterase]
MAAAQPIRLYCFAHAGAGVSAFHGWAARVGPDVVPVPVLLPGRDRRRREPRVTTRAALLD
DVMRLFGGAPTAPFVLYGHSLGALVAYTVGRALHEAGRRGPALLAVGACPPPHLPPEPAY
ALGVPDAELLRTLDLMAVVPSGTPGTEAGGIWDRAVRPVLRDDLTLARALRTAACTSSPA
DPLTTPLLIVAADDDPMASPAVAEGWSRWSEGPTRLHTVSGGHFFVRGPELPRLLGQACR
ALRPARRTPRAAGPVTSTGN
selected fasta
>putative type II thioesterase [putative thioesterase]
ATGGCCGCCGCACAGCCGATACGTCTCTACTGTTTCGCGCATGCCGGGGCGGGCGTCTCT
GCCTTCCACGGGTGGGCGGCCCGCGTCGGCCCCGACGTGGTGCCCGTCCCGGTGCTGCTG
CCCGGCCGCGACCGACGCCGCCGCGAACCCCGGGTCACCACCCGCGCGGCACTGCTCGAC
GATGTGATGCGGCTGTTCGGCGGCGCCCCGACGGCCCCGTTCGTCCTGTACGGACACAGC
CTCGGCGCCCTGGTCGCGTACACCGTCGGCCGCGCCCTGCACGAGGCGGGCCGGCGCGGC
CCCGCACTGCTCGCGGTCGGCGCCTGCCCGCCGCCTCACCTGCCGCCCGAACCGGCGTAC
GCACTCGGCGTGCCCGATGCCGAACTCCTGCGCACGCTGGACCTGATGGCCGTCGTGCCG
TCCGGCACCCCCGGCACCGAAGCCGGCGGAATCTGGGACCGTGCCGTACGGCCGGTGCTG
CGTGACGACCTGACACTCGCCCGCGCCCTGCGCACCGCGGCGTGTACATCCTCACCGGCG
GACCCGCTGACCACGCCGCTGCTCATCGTCGCCGCGGACGACGACCCGATGGCGTCACCC
GCGGTCGCGGAGGGCTGGAGCCGCTGGAGCGAGGGGCCCACGCGCCTGCACACGGTCTCC
GGGGGCCACTTCTTCGTCCGCGGCCCGGAACTGCCTCGGCTCCTCGGTCAGGCATGCCGC
GCGCTCCGCCCAGCGAGGCGCACGCCCCGCGCGGCAGGGCCGGTGACCAGCACCGGGAAC
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [8-228]  3.7e-24 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit