close all open/close all

CDS information : Mith_00040


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction5,258 / 6,640 / + [in whole cluster]
5,258 / 6,640 / + [in contig]
Location5258..6640 [in whole cluster]
5258..6640 [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 5,10-methylenetetrahydrofolate reductase
Product (GenBank)AdoMet synthetase and MTHF reductase fusion
Gene
Gene (GenBank)mtmA
EC number
Keyword
  • SAM
Note
  • Contains S-adenosylmethionine synthetase partial domain at N-terminus.
Note (GenBank)
Reference
ACC
PmId
[9882681] The mithramycin gene cluster of Streptomyces argillaceus contains a positive regulatory gene and two repeated DNA sequences that are located at both ends of the cluster. (J Bacteriol. , 1999)
Related Reference
ACC
O54235
PmId
[9515933] The folate branch of the methionine biosynthesis pathway in Streptomyces lividans: disruption of the 5,10-methylenetetrahydrofolate reductase gene leads to methionine auxotrophy. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>putative 5,10-methylenetetrahydrofolate reductase [AdoMet synthetase and MTHF reductase fusion]
MSGHLFTSESVTEGHPDKIADRISGTIPDALLREDPRSRVAVETLITTGQVYVADKVTTG
AYVPIAQLVRDAVLTIGYDSSAKGFDGACCGVSVSIGPQSPDIAQGVDTAYESLVEGAAA
GADIDELDRQDAGDQGLMFGCATDESPNLMPLPIELAYRLARRLTDVRRNGLPPTFARTA
RPGSPEDRAGRARVLWDTIRRGEALRPDFVSVTYEAGGSPRDRTVALTRRIAAETTLRPV
AHLTAVGHSVAELRQIIGRYADVGIRDVFALRGDPPGDPRGPWSPHFEGFTYAHELVEPV
RSLGDFTIRMAAFPERHPRSPDWESDIRHFVAKCRAGADYAITQMFFGPDGYLRLRDPAA
AAGCHIPIIPEIMPAMDVRQIRRFAELSAVAFTEDLAHRLEQARGNPAVGHRIGVDHATA
MAERLLAEGVPGLHCITLNRSTAALDIHRNLRTSRSLSVR
selected fasta
>putative 5,10-methylenetetrahydrofolate reductase [AdoMet synthetase and MTHF reductase fusion]
ATGTCCGGCCATCTGTTCACCTCGGAGTCCGTCACCGAGGGACACCCCGACAAGATCGCC
GACCGCATCAGCGGCACGATCCCCGACGCCCTGCTGCGCGAGGACCCCCGCTCCCGGGTC
GCCGTGGAAACGCTGATCACAACCGGCCAGGTGTACGTCGCCGATAAGGTCACCACCGGC
GCGTACGTGCCGATCGCCCAACTGGTGCGAGACGCCGTGCTCACCATCGGTTACGACTCC
TCCGCCAAGGGCTTCGACGGCGCCTGCTGCGGCGTGTCGGTGTCGATCGGCCCGCAGTCC
CCGGACATCGCGCAGGGTGTCGACACGGCGTACGAGTCCCTGGTCGAGGGCGCAGCCGCA
GGTGCGGACATCGACGAGCTGGACCGGCAGGATGCCGGCGACCAGGGCCTGATGTTCGGC
TGCGCGACCGACGAGTCCCCGAACCTGATGCCGTTGCCCATCGAACTGGCGTACCGGCTC
GCCCGCCGCCTCACCGACGTCCGCCGGAACGGACTCCCCCCTACCTTCGCCCGGACGGCA
AGACCCGGGTCACCCGAGGACCGAGCAGGGCGAGCGCGCGTGCTCTGGGACACGATCCGC
CGGGGGGAGGCGCTGCGCCCCGACTTCGTCTCCGTCACGTACGAAGCGGGCGGTTCGCCC
CGCGACCGCACGGTCGCCCTCACTCGGCGAATCGCCGCCGAGACCACTCTGAGGCCGGTC
GCCCACCTGACCGCCGTGGGCCACTCGGTCGCCGAACTGCGCCAGATCATCGGTCGGTAC
GCGGACGTCGGCATCCGTGACGTGTTCGCGTTGCGCGGGGACCCGCCCGGCGATCCCCGG
GGCCCGTGGAGCCCGCACTTTGAGGGATTCACCTACGCCCACGAGCTGGTGGAACCGGTC
CGCTCGCTGGGGGACTTCACCATCAGAATGGCCGCCTTCCCCGAGCGGCATCCGCGGTCG
CCGGACTGGGAGAGCGACATCCGGCACTTCGTCGCCAAGTGCCGGGCCGGCGCCGACTAC
GCCATCACTCAGATGTTCTTCGGCCCGGACGGCTATCTGCGGCTGCGCGACCCGGCCGCG
GCGGCCGGGTGCCACATTCCGATCATCCCGGAGATCATGCCGGCCATGGACGTCCGCCAG
ATCCGCCGCTTCGCCGAACTCTCCGCTGTCGCCTTCACCGAAGACCTGGCGCACCGTCTG
GAGCAGGCGCGGGGCAACCCCGCCGTGGGTCACCGCATCGGTGTCGACCACGCCACCGCG
ATGGCCGAGCGCCTGCTCGCCGAGGGAGTACCGGGGCTGCACTGCATCACGCTCAACCGC
TCCACCGCCGCGCTCGACATCCACCGCAACCTTCGGACCTCAAGGAGCCTCAGTGTCCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003171 Methylenetetrahydrofolate reductase (Family)
 [192-451]  1.10000000000001e-77 PF02219
PF02219   MTHFR
IPR022628 S-adenosylmethionine synthetase, N-terminal (Domain)
 [4-101]  1.09999999999999e-34 PF00438
PF00438   S-AdoMet_synt_N
IPR022629 S-adenosylmethionine synthetase, central domain (Domain)
 [129-172]  6.80000000000001e-14 PF02772
PF02772   S-AdoMet_synt_M
IPR022636 S-adenosylmethionine synthetase superfamily (Domain)
 [2-103]  1e-36 SSF55973 [128-181]  1.20000117458134e-14 SSF55973
SSF55973   S-AdoMet_synt
SignalP No significant hit
TMHMM No significant hit