close all open/close all

CDS information : Mith_00050


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction6,630 / 8,078 / + [in whole cluster]
6,630 / 8,078 / + [in contig]
Location6630..8078 [in whole cluster]
6630..8078 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative adenosylhomocysteinase
putative S-adenosyl-L-homocysteine hydrolase
Product (GenBank)adoHcyase
GenemtmH
ahcY
Gene (GenBank)mtmH
EC number3.3.1.1
Keyword
  • SAM
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
P60176
PmId
[18815415] Crystal structures of Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase in ternary complex with substrate and inhibitors. (Protein Sci. , 2008)

close this sectionSequence

selected fasta
>putative adenosylhomocysteinase [adoHcyase]
MSADFTDFKVADLSLAEFGRKEITLAEHEMPGLMSIRREYAEAQPLAGARVTGSLHMTVQ
TAVLIETLVALGAQVRWASCNIFSTQGHAAAAIAVGPDGTPDNPRAVPVFAWKGETLEEY
WWCTEQALTWPDSPTGGPNMILDDGGDATLLVHKGVEYEKDGKVPSVDTAENDEHRVILE
LLNRTITDGSQKWTQLASEIRGVTEETTTGVHRLYEMQRDGVLLFPAINVNDAVTKSKFD
NKYGCRHSLIDGINRATDVLIGGKTAVVFGYGDVGKAARSLRGQGARVIVTEIDPICALQ
AAMDGYQVTTLDEVVDKADIFITTTGNKDIIMAADMARMKHQAIVGNIGHFDNEIDMAGL
AKVPGIVKDEIKPQVHTWTFPDGKKIIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQI
ELFTKPGDYPTGVYTLPKHLDEKVARLHLDALGVKLTTLRPEQASYIGVDVDGPYKSDHY
RY
selected fasta
>putative adenosylhomocysteinase [adoHcyase]
GTGTCCGCTGACTTCACGGACTTCAAGGTCGCCGATCTCTCCCTGGCCGAGTTCGGCCGC
AAGGAGATCACCCTCGCCGAGCACGAGATGCCCGGCCTGATGTCGATCCGCAGGGAGTAC
GCCGAGGCCCAGCCCCTCGCCGGCGCCCGCGTCACCGGCTCCCTGCACATGACCGTGCAG
ACCGCCGTCCTCATCGAGACCCTGGTCGCGCTCGGCGCCCAGGTCCGCTGGGCCTCCTGC
AACATCTTCTCCACCCAGGGCCACGCGGCCGCCGCCATCGCCGTCGGCCCCGACGGCACG
CCCGACAACCCGCGGGCCGTCCCGGTCTTCGCCTGGAAGGGCGAGACGCTGGAGGAGTAC
TGGTGGTGCACCGAGCAGGCGCTGACCTGGCCGGACAGCCCCACCGGCGGCCCGAACATG
ATCCTCGACGACGGCGGTGACGCCACCTTGCTGGTCCACAAGGGCGTCGAGTACGAGAAG
GACGGCAAGGTCCCCTCGGTCGACACCGCCGAGAACGACGAGCACCGCGTCATCCTCGAA
CTCCTCAACCGCACCATCACCGACGGCTCCCAGAAGTGGACGCAGCTGGCGTCCGAGATC
CGCGGCGTGACCGAGGAGACCACCACCGGCGTCCACCGCCTGTACGAGATGCAGCGCGAC
GGTGTCCTGCTGTTCCCCGCGATCAACGTCAACGACGCGGTCACCAAGTCGAAGTTCGAC
AACAAGTACGGCTGCCGCCACTCGCTGATCGACGGCATCAACCGCGCCACCGACGTCCTG
ATCGGCGGCAAGACCGCCGTGGTCTTCGGCTACGGCGACGTCGGCAAGGCTGCGCGGAGT
CTGCGCGGCCAGGGCGCCCGCGTCATCGTCACCGAGATCGACCCGATCTGCGCACTGCAG
GCGGCGATGGACGGCTACCAGGTCACGACCCTCGACGAGGTCGTCGACAAGGCCGACATC
TTCATCACCACGACCGGCAACAAGGACATCATCATGGCCGCGGACATGGCCAGGATGAAG
CACCAGGCCATCGTCGGGAACATCGGCCACTTCGACAACGAGATCGACATGGCCGGCCTC
GCCAAGGTCCCCGGCATCGTCAAGGACGAGATCAAGCCGCAGGTCCACACCTGGACCTTC
CCCGACGGCAAGAAGATCATCGTGCTGTCCGAGGGCCGTCTGCTGAACCTGGGCAACGCC
ACCGGCCACCCGTCGTTCGTGATGTCCAACTCCTTCGCGGACCAGACCCTGGCCCAGATC
GAGCTGTTCACCAAGCCCGGCGACTACCCGACCGGCGTCTACACCCTGCCCAAGCACCTC
GACGAGAAGGTCGCCCGCCTCCACCTGGACGCGCTCGGCGTGAAGCTCACGACCCTCCGC
CCCGAGCAGGCCTCGTACATCGGCGTCGACGTCGACGGCCCGTACAAGTCGGACCACTAC
CGCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000043 Adenosylhomocysteinase (Family)
 [7-481]  SM00996
SM00996   AdoHcyase
 [8-474]  TIGR00936
TIGR00936   AhcY
 [7-481]  PF05221
PF05221   AdoHcyase
 [1-474]  PIRSF001109
PIRSF001109   Ad_hcy_hydrolase
IPR015878 S-adenosyl-L-homocysteine hydrolase, NAD binding domain (Domain)
 [241-402]  2.50000909916183e-109 SM00997
SM00997   AdoHcyase_NAD
 [241-402]  1.10000000000001e-79 PF00670
PF00670   AdoHcyase_NAD
IPR020082 S-adenosyl-L-homocysteine hydrolase, conserved site (Conserved_site)
 [263-280]  PS00739
PS00739   ADOHCYASE_2
 [79-93]  PS00738
PS00738   ADOHCYASE_1
SignalP No significant hit
TMHMM No significant hit