close all open/close all

CDS information : Mith_00060


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction8,142 / 9,209 / + [in whole cluster]
8,142 / 9,209 / + [in contig]
Location8142..9209 [in whole cluster]
8142..9209 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglucose-1-phosphate thymidylyltransferase
dTDP-glucose synthase
Product (GenBank)dTDP-glucose synthase
Gene
Gene (GenBank)mtmD
EC number2.7.7.24
Keyword
  • D-olivose
  • D-oliose
  • D-mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>glucose-1-phosphate thymidylyltransferase [dTDP-glucose synthase]
MKALVLSGGSGTRLRPITHTSPKQLVPVANKPVLFYALEDIAQAGITDVGIVVGETAREI
EDAVGDGSKFGLQVTYLPQEKPLGLAHAVLIARDYLGDDDFVMYLGDNFVVGGIAGLVDE
FRADRPDARILLTPVPDPTAFGIAELDGEGRVVRLEEKPTHPKSDMAVIGVYLFTPLVHE
AVRAIEPSWRGELEITHAIQWLIDNRHDVRSTVIHGYWKDTGNVMDMLEVNRTVLEGVEP
CTEGPVDAESEVIGRVRIEAGARVSNSRIVGPAVIGSGTVISGSYIGPYTSVSEGCRIED
SEIEFSIVLRDSRVRGVQRVRGSLIGRSVTVAPAPRKPAGTRLVLGDHSEGQISS
selected fasta
>glucose-1-phosphate thymidylyltransferase [dTDP-glucose synthase]
ATGAAGGCACTCGTTCTGTCCGGTGGCTCGGGCACACGCCTGAGGCCCATCACCCACACA
TCGCCCAAGCAGCTGGTGCCGGTGGCGAACAAACCTGTTCTCTTCTACGCCCTGGAGGAC
ATCGCGCAGGCCGGGATCACCGACGTCGGGATCGTCGTCGGTGAGACGGCCCGCGAGATC
GAGGACGCGGTGGGCGACGGTTCCAAGTTCGGCCTCCAGGTGACCTACCTGCCGCAGGAG
AAACCCCTGGGACTCGCCCACGCGGTCCTGATCGCCCGCGACTACCTCGGTGACGACGAC
TTCGTCATGTACCTGGGAGACAACTTCGTGGTCGGCGGCATCGCCGGTCTGGTGGACGAG
TTCCGTGCGGACCGGCCCGACGCGCGGATCCTGCTGACCCCCGTTCCCGATCCGACGGCC
TTCGGCATCGCCGAGCTGGACGGGGAGGGCCGGGTCGTACGCCTGGAGGAGAAGCCGACG
CACCCCAAGAGCGACATGGCGGTGATCGGCGTCTACCTGTTCACCCCGCTCGTGCACGAG
GCCGTGCGCGCCATCGAGCCGTCGTGGCGGGGGGAGCTGGAAATCACCCATGCCATCCAG
TGGCTCATCGACAACCGCCACGACGTGCGGTCTACCGTGATCCACGGCTACTGGAAGGAC
ACCGGCAACGTCATGGACATGCTGGAGGTCAACCGGACGGTGCTGGAGGGCGTCGAGCCG
TGCACCGAGGGCCCGGTCGACGCGGAGAGCGAGGTGATCGGCCGCGTCAGGATCGAGGCC
GGCGCCCGGGTCAGCAATTCGCGGATCGTCGGTCCCGCGGTGATCGGGTCGGGCACGGTG
ATCAGCGGTTCCTACATCGGGCCGTACACGTCCGTCTCCGAGGGCTGCCGGATCGAGGAC
AGCGAGATCGAGTTCTCGATCGTGCTGCGCGACTCACGGGTGCGGGGCGTCCAGCGGGTC
AGGGGGTCCCTCATCGGCCGCAGTGTCACCGTGGCCCCCGCCCCCCGCAAGCCGGCCGGC
ACCCGGCTCGTTCTCGGCGACCACAGCGAGGGGCAGATCTCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  2.50000000000001e-59 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-350]  TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit