close all open/close all

CDS information : Mith_00070


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction9,206 / 10,201 / + [in whole cluster]
9,206 / 10,201 / + [in contig]
Location9206..10201 [in whole cluster]
9206..10201 [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-glucose 4,6-dehydratase
Product (GenBank)dTDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)mtmE
EC number4.2.1.46
Keyword
  • D-olivose
  • D-oliose
  • D-mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
MTTTSILVTGGAGFIGSHYVRTLLGPRGVPDVTVTVLDKLTYAGTLTNLAEVSDSDRFRF
VRGDICDAPLVDDLLAVHDQVVHFAAESHVDRSILGAADFVRTNVTGTQTLLDAALRQGI
ETFVHISTDEVYGSIDAGSWPETAPVSPNSLYSAAKASSDLVALAYHRTHGLDVRVTRCS
NNYGSHQFPEKVIPLFVTSLLDGREVPLYGDGTNVRDWLHVDDHVRAIELVRTGGRAGEV
YNIGGGTELSNKELTQLLLDACGAGWDRVRYVTDRKGHDRRYSVDCTKIRRELGYRPARE
FGDALAETVAWYRHHRAWWEPLTRAYGAVAA
selected fasta
>dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
ATGACCACCACATCCATCCTGGTGACGGGCGGGGCCGGCTTCATCGGCTCGCACTACGTG
CGGACCCTGCTCGGTCCGCGCGGCGTGCCGGACGTGACGGTCACCGTGCTCGACAAGCTG
ACGTACGCCGGGACCCTCACCAACCTCGCCGAGGTGAGCGACAGCGACCGGTTCCGGTTC
GTCCGGGGCGACATCTGCGACGCACCCCTGGTCGACGACCTGCTCGCAGTGCACGACCAA
GTGGTGCACTTCGCCGCCGAGTCGCACGTCGACCGGTCCATTCTGGGCGCCGCCGACTTC
GTACGCACCAATGTCACCGGTACCCAGACGCTCCTCGACGCGGCGCTGCGGCAGGGGATC
GAGACGTTCGTGCACATCTCCACCGACGAGGTGTACGGCTCCATCGACGCCGGGTCCTGG
CCGGAGACGGCGCCGGTCAGCCCCAACTCGCTCTATTCCGCAGCCAAGGCGTCCAGCGAT
CTCGTGGCGCTGGCCTACCACCGCACCCACGGTCTGGACGTGCGGGTCACGCGTTGCTCG
AACAACTACGGGTCCCATCAGTTCCCGGAGAAGGTCATCCCGCTGTTCGTCACCAGTCTG
CTCGACGGCCGCGAGGTGCCGTTGTACGGGGACGGCACCAACGTACGCGACTGGCTGCAC
GTCGACGACCACGTCCGCGCGATCGAGCTGGTCCGCACGGGAGGTCGGGCCGGCGAGGTC
TACAACATCGGCGGCGGCACCGAGCTGTCCAACAAGGAGCTGACGCAGCTGCTCCTGGAC
GCCTGTGGCGCCGGCTGGGACCGCGTGCGGTACGTCACCGACCGCAAGGGGCACGACCGG
CGCTACTCCGTCGACTGCACGAAGATCCGGCGTGAGCTCGGGTACCGGCCGGCTCGGGAG
TTCGGGGACGCACTGGCCGAGACTGTCGCCTGGTACCGCCACCACCGTGCCTGGTGGGAG
CCGCTGACGCGGGCGTACGGGGCGGTGGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-244]  5.90000000000008e-66 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [6-322]  4.09999999999995e-128 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [6-200]  1.70000000000001e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit