close all open/close all

CDS information : Mith_00080


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction11,381 / 10,620 / - [in whole cluster]
11,381 / 10,620 / - [in contig]
Locationcomplement(10620..11381) [in whole cluster]
complement(10620..11381) [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)mtmTII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
[16856198] Premithramycinone G, an early shunt product of the mithramycin biosynthetic pathway accumulated upon inactivation of oxygenase MtmOII. (Angew Chem Int Ed Engl. , 2006)
Related Reference
ACC
P23238
PmId
[3286259] The NADPH-linked acetoacetyl-CoA reductase from Zoogloea ramigera. Characterization and mechanistic studies of the cloned enzyme over-produced in Escherichia coli. (Eur J Biochem. , 1988)

close this sectionSequence

selected fasta
>putative oxidoreductase [ketoreductase]
MDMGLTGRRVLVTGGSSGIGAAVARAYADEGARVALTYRGGDEAAERLARELGAGRHAAM
AVRYSLGEPDTVESAVATVTERWGGVDVLVANAVRWAPRRAPGTRFEEVASGDWRGFLDD
NLAPTLRTVQLVVAGMRARSWGRIVLISSHVALDGHRGQEFYGAAKSALHGFARSLAWDV
GRDGVLVNVVCPGLTTTERVLTGLPDEIRERELGSTPTGRLSSPEDIAGAVLFLGSAANA
NTTGQTLTVSGGR
selected fasta
>putative oxidoreductase [ketoreductase]
ATGGACATGGGACTGACAGGCCGCAGGGTGCTCGTCACGGGCGGGTCCTCCGGAATCGGT
GCGGCCGTCGCGCGCGCCTACGCGGACGAGGGGGCGCGGGTCGCCCTCACCTACCGCGGC
GGCGACGAGGCGGCCGAACGGCTCGCCCGTGAACTCGGCGCGGGCCGGCACGCGGCAATG
GCGGTGCGGTACTCCCTCGGGGAGCCGGACACCGTGGAGTCGGCCGTCGCCACGGTGACC
GAACGCTGGGGCGGGGTGGACGTGCTCGTCGCGAACGCGGTGCGCTGGGCTCCCCGCCGG
GCGCCCGGCACCCGGTTCGAGGAGGTCGCGTCCGGGGACTGGCGGGGTTTCCTCGACGAC
AACCTGGCGCCGACCCTGCGTACCGTGCAGCTGGTGGTGGCCGGGATGCGGGCGCGGTCC
TGGGGCAGGATCGTGCTCATCTCCTCGCATGTGGCCCTCGACGGCCACCGCGGGCAGGAG
TTCTACGGCGCCGCCAAGTCGGCGCTGCACGGCTTCGCCCGCAGTCTGGCCTGGGACGTG
GGCCGTGACGGTGTCCTGGTGAACGTCGTGTGCCCGGGGCTGACCACCACCGAGCGCGTG
CTCACCGGGCTGCCCGACGAGATCCGCGAGCGTGAGCTCGGCTCGACCCCCACCGGTCGG
CTCAGCAGCCCCGAGGACATCGCCGGCGCGGTGCTCTTCCTGGGCTCGGCGGCCAACGCC
AACACGACGGGCCAGACCCTCACGGTCTCCGGCGGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [84-95]  1.60000065022528e-05 PR00080 [142-150]  1.60000065022528e-05 PR00080 [162-181]  1.60000065022528e-05 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  8.5000302480906e-36 PR00081 [84-95]  8.5000302480906e-36 PR00081 [136-152]  8.5000302480906e-36 PR00081 [162-181]  8.5000302480906e-36 PR00081 [183-200]  8.5000302480906e-36 PR00081 [217-237]  8.5000302480906e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-252]  1.29999999999998e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [149-177]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit