close all open/close all

CDS information : Mith_00090


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction12,993 / 11,398 / - [in whole cluster]
12,993 / 11,398 / - [in contig]
Locationcomplement(11398..12993) [in whole cluster]
complement(11398..12993) [in contig]
TypeCDS
Length1,596 bp (531 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)oxygenase
Gene
Gene (GenBank)mtmOII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
[16856198] Premithramycinone G, an early shunt product of the mithramycin biosynthetic pathway accumulated upon inactivation of oxygenase MtmOII. (Angew Chem Int Ed Engl. , 2006)
Related Reference
ACC
Q3S8Q4
NITE
Oxtet_00120
PmId
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
ACC
Q8KUF9
NITE
Ansam_00130
PmId
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
ACC
Q54171
NITE
Urd_00100
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxygenase]
MADPTRVLVAGAGPVGLTAAHELARRGLRVRLIDAAPRPAATSRAVATHPRTLETYDQMG
VIEEILENAQQIRAFTMFSRGRRLVRLDADYTTMPTRFPFTAIVEQVDTEAVLRSAVARL
GVDVEWETRLTGFSQDAEGVDVTLEHADGTTESTRVPWLVGCDGGHSTVRKLLGLPLLGE
SSETWMLADAPVDVDLPRDSIYWVHTGSQALMMVPFRRGGRWRLLDTTTAEPGTDAAVIA
DRFTRNSAPASAVRQVRTPTWTSVFTFQQRMVPRMGEGRVFVAGDAAHVHSPASGRGMNT
GVQEAYNLAWKLALVAEGHAERELLDSYSLERVPIGERLLGSTKKATFLVQLKNAFAPIA
LPVVFGLIRNVPPLRRKVQRQVLGGISGLQLDYPDSPLTRPAATGAGPRPGTRASVGSGA
DPADPGCRAWAEELRDTRWTLAVTPDAVAGAPAANSWLSVRTLGDGSQGPGPLADPNGRL
RAALGLASGGWLLVRPDGYVAARGRALGGADLRQALAAAGLRDEQHVLPHS
selected fasta
>putative oxidoreductase [oxygenase]
GTGGCTGACCCGACCCGGGTGCTCGTGGCGGGGGCCGGCCCGGTCGGTCTCACCGCCGCC
CATGAACTCGCCCGGCGGGGGCTGCGGGTGCGGCTGATCGACGCCGCGCCCCGCCCCGCG
GCCACCAGCCGCGCCGTGGCCACCCACCCGCGGACCCTGGAGACGTACGACCAGATGGGC
GTCATCGAGGAGATCCTCGAGAACGCCCAGCAGATCCGCGCGTTCACCATGTTCAGCCGG
GGTCGCCGGCTGGTGCGGCTGGACGCCGACTACACGACCATGCCGACGCGCTTCCCGTTC
ACGGCGATCGTCGAGCAGGTGGACACCGAGGCCGTGCTGCGCTCCGCGGTGGCCCGGCTC
GGCGTGGACGTCGAGTGGGAGACGCGGCTAACCGGGTTCTCCCAGGACGCGGAGGGTGTG
GACGTCACACTCGAACACGCCGACGGGACCACGGAGTCCACTCGGGTGCCCTGGCTGGTC
GGCTGCGACGGCGGCCACAGCACCGTGCGCAAACTGCTCGGACTGCCCCTGCTCGGTGAG
TCCAGCGAGACCTGGATGTTGGCCGACGCCCCCGTCGACGTGGACCTGCCGCGCGACAGC
ATCTACTGGGTCCACACCGGCTCCCAGGCCCTGATGATGGTGCCCTTCCGACGCGGCGGC
CGGTGGCGTCTGCTGGACACGACCACCGCCGAGCCCGGCACCGACGCCGCCGTGATCGCC
GACCGCTTCACGCGCAACTCGGCCCCGGCCTCGGCCGTCCGCCAGGTGCGCACCCCCACT
TGGACGTCGGTCTTCACCTTCCAGCAGCGGATGGTGCCGCGCATGGGCGAAGGCCGGGTC
TTTGTCGCGGGTGACGCCGCCCATGTGCACAGCCCGGCCTCCGGGAGGGGCATGAACACG
GGCGTCCAGGAGGCGTACAACCTGGCCTGGAAGCTGGCGCTGGTCGCCGAGGGACACGCG
GAACGGGAACTGCTCGACAGTTACAGCCTGGAGCGGGTACCGATCGGCGAGCGGTTGCTC
GGCTCGACCAAGAAGGCGACCTTCCTGGTGCAACTGAAGAACGCCTTCGCGCCGATCGCC
CTCCCCGTCGTCTTCGGCCTCATCCGCAACGTCCCGCCGCTGCGGAGGAAGGTGCAGCGC
CAGGTCCTGGGCGGCATCTCCGGACTTCAGCTCGACTACCCCGACTCACCGCTGACGCGG
CCCGCCGCCACCGGTGCCGGGCCGCGTCCGGGCACCCGCGCCTCGGTGGGATCGGGCGCC
GACCCGGCCGACCCCGGCTGCCGGGCCTGGGCGGAGGAACTGCGCGACACGCGCTGGACG
CTGGCGGTGACGCCGGATGCGGTGGCCGGGGCACCGGCGGCGAACAGCTGGTTGTCCGTG
CGCACGCTCGGCGACGGCAGCCAGGGGCCCGGCCCGCTTGCCGACCCGAACGGCCGGCTG
CGCGCCGCGTTGGGACTCGCGTCCGGCGGCTGGCTCTTGGTCCGCCCGGACGGTTACGTC
GCCGCGCGCGGCCGGGCACTCGGCGGCGCGGACCTGCGGCAGGCCCTGGCCGCCGCGGGT
CTGCGCGACGAACAGCACGTCCTCCCCCACTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [5-340]  5.69999999999998e-80 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [6-28]  4.39999001237725e-44 PR00420 [155-170]  4.39999001237725e-44 PR00420 [277-292]  4.39999001237725e-44 PR00420 [292-308]  4.39999001237725e-44 PR00420 [310-328]  4.39999001237725e-44 PR00420 [328-344]  4.39999001237725e-44 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit