close all open/close all

CDS information : Mith_00100


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction13,285 / 12,986 / - [in whole cluster]
13,285 / 12,986 / - [in contig]
Locationcomplement(12986..13285) [in whole cluster]
complement(12986..13285) [in contig]
TypeCDS
Length300 bp (99 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxygenase
Gene
Gene (GenBank)mtmOIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxygenase]
MVTFVNKLTVNGDIEEFLTIKRSLTEFMSAQPGYRSSTTLRQVGRPDVFIELAEWDDAAS
HQAAVRSEEFQARVKGLGALASVDPGLYEEASEDGAGRG
selected fasta
>putative oxidoreductase [oxygenase]
GTGGTGACCTTCGTCAACAAGCTGACCGTCAACGGCGACATCGAGGAATTCCTCACGATC
AAGCGGTCGCTGACCGAGTTCATGTCCGCCCAGCCCGGATACCGCAGCTCCACCACGCTG
CGCCAGGTCGGCCGGCCCGACGTGTTCATCGAGCTGGCCGAGTGGGACGACGCCGCCTCC
CACCAGGCAGCGGTGCGCAGCGAGGAGTTCCAGGCGCGGGTCAAGGGCCTCGGTGCGCTG
GCGAGCGTGGACCCGGGGCTCTACGAGGAGGCCTCCGAGGACGGGGCCGGCCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [1-74]  2.3e-12 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-87]  4.60000044330862e-16 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit