close all open/close all

CDS information : Mith_00110


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction14,873 / 13,329 / - [in whole cluster]
14,873 / 13,329 / - [in contig]
Locationcomplement(13329..14873) [in whole cluster]
complement(13329..14873) [in contig]
TypeCDS
Length1,545 bp (514 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ligase
Product (GenBank)acyl CoA ligase
Gene
Gene (GenBank)mtmL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
Related Reference
ACC
P41636
PmId
[9008388] Molecular cloning of 4-coumarate:coenzyme A ligase in loblolly pine and the roles of this enzyme in the biosynthesis of lignin in compression wood. (Plant Physiol. , 1997)

close this sectionSequence

selected fasta
>putative ligase [acyl CoA ligase]
MSELPPGPAVPLDGLLRLAAERHPEQVAVRDERGAVDYAGLDARADRFARALLRLTGGRP
TAVGVASVLDPVFAAAFYGTSRSGNRVVLVNPLVREPVLEHVFRTAGIEIALVSAETRSP
GGRRAALPDLREVYVVDADRTGPPPPGTRPLDDLLTEDGTAALPDPAGVDLDSVVCVQFT
SGTTGPPKGVRLTHRNLVANAAQAAHALGLDAGSVCLNHLPLYHVMHLDSAVYAGATQVL
CHDPDPVASVAAAAEAGATHYFGLPVRLARLAADPRLASVVPGPELGLVRSGGSRLAPAV
AARLRERLGVPVIQGYGLAELSPLSHNDRPERSKPGSVGPAVPGTECRIVDLETGAALDP
GRPGEVLLRGPQLMAGYLGLPDAPDIDAAGWFHTGDVGYQDEDGWLFLVDRIKDVFKVDN
ELVSPSEIEQVLLQDPDVADCVVADLPDEFSGAVVWAGVVPAGDGPVDLNPIVARANALL
SDHQRIRRAERLTAVPRSPNGKTERTRLRERLRA
selected fasta
>putative ligase [acyl CoA ligase]
GTGTCTGAGCTCCCGCCCGGGCCGGCGGTACCGCTGGACGGGTTGCTGCGCCTGGCCGCC
GAGCGGCACCCGGAGCAGGTCGCCGTGCGCGACGAGCGCGGAGCCGTCGACTACGCCGGA
CTCGACGCCCGCGCCGACCGGTTCGCCCGCGCCCTGCTGCGGCTGACCGGCGGCCGGCCG
ACGGCCGTCGGCGTGGCGAGCGTGCTGGACCCGGTGTTCGCGGCGGCCTTCTACGGCACC
AGCCGCAGCGGCAACCGCGTCGTGCTGGTCAACCCGCTGGTGCGCGAACCCGTCCTGGAG
CACGTCTTCCGCACGGCCGGCATCGAGATCGCGCTGGTCTCCGCCGAGACCCGGTCCCCT
GGCGGCCGTCGCGCCGCTCTCCCCGACCTGCGGGAGGTCTACGTGGTCGACGCGGACCGG
ACCGGGCCGCCGCCCCCGGGAACCCGCCCCCTGGACGACCTCCTCACCGAGGACGGCACG
GCCGCGCTGCCCGACCCGGCCGGTGTCGACCTGGACTCCGTCGTCTGCGTGCAGTTCACC
AGTGGCACCACCGGTCCCCCGAAGGGCGTCCGGCTCACCCACCGCAACCTGGTGGCCAAC
GCCGCCCAGGCGGCACACGCACTCGGCCTCGACGCCGGCAGCGTCTGCCTCAACCACCTG
CCGCTCTACCACGTCATGCACCTCGACTCGGCCGTGTACGCGGGCGCCACCCAGGTGCTG
TGCCACGACCCCGACCCGGTCGCCTCGGTCGCCGCGGCGGCCGAGGCCGGAGCCACCCAC
TACTTCGGGTTGCCGGTACGGCTGGCCAGACTGGCGGCGGACCCGCGGCTGGCCTCGGTC
GTCCCCGGGCCCGAACTGGGGCTGGTGCGCTCCGGCGGCTCCCGGCTCGCCCCCGCCGTC
GCGGCCCGCCTGCGCGAGCGGCTCGGCGTGCCGGTCATCCAGGGATACGGGCTCGCCGAA
CTCTCGCCGCTCAGCCACAACGACCGTCCGGAGCGGAGCAAGCCCGGCTCGGTCGGTCCG
GCCGTCCCCGGCACCGAGTGCCGCATCGTGGACCTGGAGACCGGAGCCGCCCTTGACCCC
GGCCGGCCGGGCGAGGTCCTGCTGCGCGGACCGCAGCTGATGGCCGGGTACCTCGGCCTG
CCGGACGCCCCGGACATCGACGCCGCAGGCTGGTTCCATACCGGCGACGTCGGCTACCAG
GACGAGGACGGCTGGCTGTTCCTGGTCGACCGCATCAAGGACGTCTTCAAGGTCGACAAC
GAACTCGTGTCGCCGAGCGAGATCGAACAGGTCCTGCTGCAGGACCCGGACGTCGCCGAC
TGTGTGGTGGCCGACCTGCCCGACGAGTTCAGCGGCGCCGTCGTCTGGGCCGGCGTCGTA
CCCGCCGGTGACGGGCCGGTGGACCTGAACCCGATCGTGGCCCGGGCCAACGCCCTGCTC
TCCGACCACCAGCGCATCCGCCGCGCCGAACGGCTCACGGCCGTGCCCCGCTCCCCGAAC
GGCAAGACCGAACGAACGCGGCTGCGCGAGCGGCTGCGCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [38-443]  3.90000000000001e-83 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [177-188]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit