close all open/close all

CDS information : Mith_00120


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction15,813 / 14,866 / - [in whole cluster]
15,813 / 14,866 / - [in contig]
Locationcomplement(14866..15813) [in whole cluster]
complement(14866..15813) [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)mtmQ
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[8654997] Characterization of Streptomyces argillaceus genes encoding a polyketide synthase involved in the biosynthesis of the antitumor mithramycin. (Gene. , 1996)
Related Reference
ACC
Q2PA00
NITE
Stref_00150
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MPNSQQYSVRDEILVAAPAERVRSLVDDVVGWTQLHGPAVHAHVLRDTGDERLIRHWAVT
GRNSVRTWTARHTRSADASRISFAHVMPEAPFASLEGAWTFRERDGKTRVEMRHDFTLSD
GSAGPADELTARLREGSRAYLSTLGHAAENHEELDRLIISFTDSLFIAGDVKDAYDYLWE
ADKWEERIPHIAKLDLEEPAPGVQFFDMLTSTPDGSSHRTRSVRVTVEPDIIVYKQTELP
ALLDGHTGHWKFTRTPEGVIAEARHTATVKPSALHILGEGTTVQDARNYLRRVLSANSVS
NLRLAKAYAEERAGV
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGCCGAACAGCCAGCAGTACTCCGTCCGGGACGAGATCCTCGTCGCCGCCCCGGCCGAG
CGGGTCCGCTCACTGGTCGACGACGTCGTCGGCTGGACGCAGCTGCACGGCCCCGCCGTC
CACGCCCATGTCCTTCGGGACACCGGCGACGAGCGGCTGATCCGGCACTGGGCCGTCACC
GGCCGGAACTCTGTCCGCACCTGGACGGCACGCCACACCAGGTCCGCCGACGCCAGCCGG
ATCTCCTTCGCGCACGTGATGCCCGAGGCGCCGTTCGCGTCCCTGGAAGGCGCCTGGACC
TTCCGGGAACGGGACGGCAAGACGCGGGTCGAGATGCGTCACGACTTCACCCTGTCCGAC
GGCTCGGCCGGTCCGGCGGACGAGCTGACCGCCCGACTGCGCGAAGGAAGCCGCGCGTAT
CTGAGCACCCTCGGCCACGCCGCCGAGAACCACGAAGAACTGGACCGCCTGATCATCTCC
TTCACGGACTCCCTGTTCATCGCGGGCGACGTCAAGGACGCCTACGACTACCTGTGGGAG
GCGGACAAGTGGGAGGAGCGCATCCCCCACATCGCCAAGCTCGACCTGGAGGAGCCCGCG
CCCGGGGTCCAGTTCTTCGACATGCTCACCTCCACCCCCGACGGCTCCTCGCACCGCACC
CGCTCGGTCCGGGTCACCGTCGAGCCGGACATCATCGTGTACAAGCAGACCGAGCTGCCC
GCCCTGCTCGACGGGCACACCGGGCACTGGAAGTTCACCCGGACCCCCGAGGGCGTCATC
GCCGAGGCCCGGCACACGGCGACCGTCAAGCCGTCGGCCCTGCACATCCTCGGCGAGGGC
ACCACGGTCCAGGACGCGCGCAACTACCTGCGCCGGGTGCTGAGCGCCAACAGTGTCAGC
AACCTGCGCCTGGCCAAGGCGTACGCCGAGGAGCGCGCCGGTGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [7-144]  4.1e-10 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [9-119]  1.4e-11 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit