close all open/close all

CDS information : Mith_00140


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction16,658 / 17,926 / + [in whole cluster]
16,658 / 17,926 / + [in contig]
Location16658..17926 [in whole cluster]
16658..17926 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketoacyl synthase
Gene
Gene (GenBank)mtmP
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[8654997] Characterization of Streptomyces argillaceus genes encoding a polyketide synthase involved in the biosynthesis of the antitumor mithramycin. (Gene. , 1996)
Related Reference
ACC
Q54495
NITE
Nogl_00370
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..374

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
MNRRVVITGIGVVAPGAVGVEAFWEQLTAGRTATRTISLFDASAFRSRIAAEVDFDAARH
GFGPAEAERLDRATQFALVSAREAVADAGLDGKTDPSRTGVALGSAVGCTTGLDTQYNVV
SEGGSDWYVDHTRAVDHLFDYFVPSSMAAEVAWSIGAQGPVALISTGCTSGLDSLGHAVA
LIREGSADVMVAGATEAPISPITVACFDAIKATSPRNDDPATASRPFDRSRNGFVLGEGS
AVLILESLENARRRDAHVYAEISGFASRCNAYHMTGLRPDGIEMAEAIRTALDEARLDPT
AVDYVNAHGSGTKQNDRHETAAFKRSLKDHAYRVPVSSIKSMIGHSLGAIGSLEVAASAL
AIEHDTVPPTANLHDRDPACDLDYTPITAREQRTDTVLSVGSGFGGFQSAMVLTAPGLRE
AA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
ATGAACCGTCGCGTCGTCATCACCGGCATCGGGGTCGTGGCCCCGGGGGCGGTGGGAGTC
GAGGCGTTCTGGGAGCAGCTCACCGCGGGCCGTACGGCCACCCGGACGATCAGTCTCTTC
GACGCCTCCGCGTTCCGCTCCCGGATCGCTGCCGAAGTGGACTTCGACGCGGCCCGGCAC
GGCTTCGGCCCCGCCGAGGCCGAACGCCTCGACCGGGCCACCCAGTTCGCCCTCGTCAGT
GCCCGCGAGGCCGTCGCCGACGCCGGCCTCGACGGCAAGACCGACCCGTCGCGCACCGGC
GTGGCGCTCGGCAGCGCGGTCGGCTGTACGACGGGTCTGGACACCCAGTACAACGTCGTG
AGCGAGGGCGGCTCCGACTGGTACGTCGACCACACCCGCGCGGTCGACCATCTCTTCGAC
TACTTCGTGCCCAGCTCCATGGCCGCCGAGGTCGCCTGGAGCATCGGTGCGCAGGGCCCC
GTGGCGCTGATCTCCACGGGCTGCACCTCCGGTCTCGACTCCCTCGGTCACGCCGTCGCG
CTGATCCGGGAGGGCAGTGCGGACGTGATGGTCGCAGGCGCGACCGAGGCACCGATCTCA
CCGATCACCGTCGCCTGCTTCGACGCCATCAAGGCCACCTCGCCGCGCAACGACGACCCG
GCCACCGCGTCCCGGCCGTTCGACCGCAGCCGCAACGGCTTCGTGCTCGGGGAGGGCAGC
GCCGTGCTCATCCTGGAGAGCCTCGAAAACGCCCGCCGCCGCGACGCCCACGTCTACGCC
GAGATCTCGGGGTTCGCCAGTCGCTGCAACGCGTACCACATGACGGGGCTGCGGCCCGAC
GGCATCGAGATGGCGGAGGCGATCCGCACCGCTCTCGACGAGGCACGCCTGGACCCCACG
GCCGTCGACTACGTCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGGCACGAGACC
GCCGCCTTCAAGCGCAGTCTCAAGGACCACGCCTACCGGGTCCCGGTGAGTTCCATCAAG
TCGATGATCGGGCACTCGCTCGGTGCCATCGGCTCCCTGGAGGTGGCCGCCAGCGCGCTG
GCCATCGAGCACGACACGGTACCTCCGACGGCCAACCTGCACGACCGGGACCCGGCCTGC
GACCTCGACTACACCCCGATCACCGCCCGTGAACAGCGCACCGACACCGTCCTGAGCGTG
GGCAGCGGATTCGGCGGCTTCCAGAGCGCCATGGTGCTGACGGCGCCCGGACTCCGGGAG
GCGGCATGA
KS3..374
KS7..1122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-250]  8.30000000000004e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [259-374]  1.6e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-264]  1.20000000000001e-66 G3DSA:3.40.47.10 [269-415]  9.9e-51 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-415]  2.80000504261099e-68 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [159-175]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit