close all open/close all

CDS information : Mith_00170


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction19,497 / 20,261 / + [in whole cluster]
19,497 / 20,261 / + [in contig]
Location19497..20261 [in whole cluster]
19497..20261 [in contig]
TypeCDS
Length765 bp (254 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)mtmTI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
Related Reference
ACC
P95727
PmId
[1597409] Purification and characterization of a novel enoyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1992)
[8955309] Cloning and characterization of the gene encoding 1-cyclohexenylcarbonyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1996)
[10973220] Identification of a cyclohexylcarbonyl CoA biosynthetic gene cluster and application in the production of doramectin. (Nat Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [ketoreductase]
MTTHHSTAPALTGRTALVTGATRGVGFAIARKLCARGADVLLDYAEDEANAARAVGALAG
LPGRAAAVRADVTVDFDALCDEVGQRFGHLDIFVHNTSYFRPAPTLATTPEQVDRSLAVA
LRPLLTGASRLAGLMAGRPGRIVAVSSTGAHRVVPRYAGAGMAKAALESLVRYLAVELAG
RGIAVNAVAAAKVDKGDGTVPAEVAEAITARTPGGRLTRPEDVADAVSLLCTDEARWLQG
QVVTVDGGLGLVAG
selected fasta
>putative oxidoreductase [ketoreductase]
GTGACCACGCACCACTCCACAGCCCCGGCCCTGACCGGCCGCACCGCGCTGGTGACCGGC
GCCACCCGGGGCGTGGGCTTCGCCATCGCCCGCAAACTGTGCGCCCGCGGCGCCGACGTC
CTGCTCGACTACGCCGAGGACGAGGCGAACGCCGCGCGGGCCGTCGGGGCGCTGGCCGGC
CTGCCGGGCCGGGCCGCCGCCGTCCGGGCCGATGTCACCGTCGACTTCGACGCCCTGTGC
GACGAGGTCGGGCAGCGCTTCGGCCACCTCGACATCTTCGTCCACAACACCTCCTACTTC
CGGCCCGCGCCCACCCTCGCCACCACGCCGGAGCAGGTGGACCGCTCCCTGGCCGTGGCG
CTGCGTCCCCTGCTCACCGGGGCCTCCCGGCTGGCCGGGCTAATGGCGGGACGCCCAGGC
AGGATCGTCGCCGTCTCCAGCACCGGTGCCCACCGGGTGGTGCCCCGGTACGCCGGGGCG
GGCATGGCCAAGGCCGCGCTGGAGTCCCTCGTGCGGTACCTCGCGGTGGAGCTGGCCGGA
CGCGGCATCGCCGTCAACGCGGTCGCCGCGGCCAAGGTCGACAAGGGGGACGGGACCGTT
CCGGCCGAGGTCGCCGAGGCGATCACCGCACGTACGCCCGGGGGACGGCTCACCCGCCCC
GAGGACGTCGCCGACGCCGTCAGCCTGCTGTGCACGGACGAGGCGCGCTGGCTGCAGGGC
CAGGTCGTGACGGTCGACGGCGGCCTGGGTCTGGTGGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [15-32]  2.90000354677981e-27 PR00081 [88-99]  2.90000354677981e-27 PR00081 [134-150]  2.90000354677981e-27 PR00081 [160-179]  2.90000354677981e-27 PR00081 [181-198]  2.90000354677981e-27 PR00081 [213-233]  2.90000354677981e-27 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [11-250]  3.99999999999998e-61 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit