close all open/close all

CDS information : Mith_00180


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction20,265 / 21,575 / + [in whole cluster]
20,265 / 21,575 / + [in contig]
Location20265..21575 [in whole cluster]
20265..21575 [in contig]
TypeCDS
Length1,311 bp (436 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxygenase
Gene
Gene (GenBank)mtmOI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
Related Reference
ACC
Q3S8R0
NITE
Oxtet_00060
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
[19472250] Identification of OxyE as an ancillary oxygenase during tetracycline biosynthesis. (Chembiochem. , 2009)
ACC
Q70DW2
NITE
Resis_00160
PmId
[17090047] The boat-shaped polyketide resistoflavin results from re-facial central hydroxylation of the discoid metabolite resistomycin. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxygenase]
MDKTTGTTSSGTPAPDEGLHTDVCVVGGGPAGLALALMLLRSGVRVTLLEKSARFDRAFR
GEILQPGGQRILGDLGVLAAARAAGACELNGFQLVDRDRVLLDIDYRRLPAPYRHLLAMP
QRHLLDALLEQCRALPGFRFLDGHRIGALVEEDGRITGAVARGPGGRRTVRARVVVGADG
GFSKTRALAGIGAGRVEAFGHDVLWFTVRAPGRQTGYVRIHRTAGNPVLVHDSHPDRLQI
GWTLPHRSWPELAARGGDEVRGELTTALPQFADLIEASVSDLSDLSLLDVYAGKADAWTR
DGLVLIGDSAHTHSPLGAQGINLALQDAAVLHPVLVAALRDGCVDQARFAPYLETRMPAV
DVVMRMQQMQAKGMFGTGGPVADRLRSGVARLIRHSPLGRKITHRVAYGHPVVEVRTDLF
TTGPTARAERTGGPKG
selected fasta
>putative oxidoreductase [oxygenase]
ATGGACAAGACCACCGGCACCACGTCCTCCGGCACGCCCGCTCCCGACGAGGGGCTGCAC
ACCGACGTCTGCGTCGTCGGCGGAGGGCCCGCGGGGCTCGCCCTCGCCCTGATGCTGCTG
CGCTCGGGGGTGCGGGTCACCCTCCTGGAGAAGTCGGCACGGTTCGACCGTGCCTTCCGC
GGCGAGATTCTCCAGCCTGGAGGCCAGCGCATCCTCGGCGACCTGGGCGTCCTCGCCGCG
GCGCGCGCCGCCGGGGCGTGCGAACTCAACGGCTTCCAGCTCGTCGACCGTGACCGCGTC
CTGCTCGACATCGACTACCGGCGGCTGCCCGCCCCGTACCGCCATCTGCTGGCGATGCCC
CAGCGCCACCTGCTCGACGCGCTCCTGGAGCAGTGCCGGGCACTGCCCGGCTTCCGCTTC
CTCGACGGACACCGGATCGGCGCCCTGGTGGAGGAGGACGGCCGGATCACCGGCGCCGTC
GCCCGTGGCCCGGGCGGCCGGCGCACCGTGCGCGCCCGGGTCGTCGTGGGGGCCGACGGC
GGGTTCTCCAAGACCCGTGCGCTGGCGGGGATCGGCGCGGGTCGGGTGGAGGCGTTCGGG
CACGACGTGCTGTGGTTCACAGTGCGCGCGCCCGGCCGGCAGACCGGGTACGTCCGTATC
CACCGCACCGCGGGAAACCCCGTCCTGGTGCACGACTCCCACCCCGACCGGTTGCAGATC
GGCTGGACACTGCCGCACCGGAGCTGGCCGGAACTCGCCGCCCGGGGGGGCGACGAGGTC
CGGGGCGAACTGACCACGGCGCTGCCGCAGTTCGCGGACCTCATCGAGGCCTCCGTGAGC
GACCTGTCCGACCTCAGCCTGCTCGACGTCTACGCCGGGAAGGCCGACGCCTGGACGCGC
GACGGCCTCGTGCTGATCGGCGACAGCGCCCACACGCACAGCCCGCTGGGCGCCCAGGGC
ATCAACCTCGCCCTTCAGGACGCGGCCGTGCTCCATCCGGTGCTGGTGGCGGCGCTGCGG
GACGGGTGTGTGGACCAAGCGCGTTTCGCCCCGTACCTCGAGACCCGGATGCCCGCCGTG
GACGTTGTCATGCGGATGCAGCAGATGCAGGCCAAAGGCATGTTCGGGACCGGCGGGCCG
GTGGCCGACCGGCTGCGCTCGGGTGTCGCCCGGCTGATCCGGCACAGCCCGCTCGGCAGG
AAGATCACCCACCGGGTGGCCTACGGGCATCCGGTGGTGGAGGTCCGTACCGATCTGTTC
ACCACCGGCCCGACCGCCCGTGCCGAGCGTACGGGCGGCCCGAAGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [21-364]  2.1e-43 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [22-44]  3.69999438558106e-24 PR00420 [171-186]  3.69999438558106e-24 PR00420 [300-315]  3.69999438558106e-24 PR00420 [315-331]  3.69999438558106e-24 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit