close all open/close all

CDS information : Mith_00190


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction21,579 / 22,352 / + [in whole cluster]
21,579 / 22,352 / + [in contig]
Location21579..22352 [in whole cluster]
21579..22352 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)cyclase
Gene
Gene (GenBank)mtmY
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
Related Reference
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)

close this sectionSequence

selected fasta
>putative cyclase [cyclase]
MRIVDLSSPVDATAWEPDPVVHEILTPAEGARHMSEEMKAHFGIDFDPSVLPEGELLSLD
TFTLTSHTGTHVDAPSHYGSTGAYGTARHIHEMPLDWFHRPAIRLDLRDQPVGAVGVGVL
EREIARIGRAPRPYDIVLLNTGASVHLGTEKYFTDFTGLDGEATDFLLDLGVRVIGTDAF
SLDAPFGDMIRRYRKTGDRSVLWPAHFAGRRREYCQIERLNNLEALPGDFGYTVSCLPVK
LVGSGAGWARAVALVDD
selected fasta
>putative cyclase [cyclase]
ATGCGTATCGTCGACCTCTCCTCGCCCGTGGACGCCACGGCCTGGGAGCCCGACCCCGTC
GTCCACGAGATCCTCACGCCGGCCGAGGGGGCCCGGCACATGAGCGAGGAGATGAAGGCC
CACTTCGGCATCGACTTCGATCCGTCGGTGCTGCCGGAGGGCGAACTGCTGTCGCTGGAC
ACGTTCACGCTCACCAGCCACACCGGGACCCATGTGGACGCGCCGTCCCACTACGGTTCG
ACGGGCGCGTACGGCACGGCGCGGCACATCCACGAGATGCCGCTGGACTGGTTCCACCGC
CCGGCGATCCGGCTCGACCTGCGCGACCAGCCGGTGGGCGCCGTGGGAGTCGGGGTCCTG
GAGCGGGAGATCGCCCGGATCGGCCGCGCCCCCCGGCCTTACGACATCGTCCTGCTGAAC
ACCGGAGCCTCCGTGCACCTGGGCACCGAGAAGTACTTCACCGACTTCACCGGACTCGAC
GGCGAGGCCACCGACTTCCTGCTCGACCTGGGGGTCAGGGTCATCGGCACCGATGCCTTC
AGCCTCGACGCGCCCTTCGGCGACATGATCCGCCGGTACCGGAAGACCGGTGACCGCTCC
GTCCTGTGGCCCGCGCATTTCGCCGGCCGCCGGCGCGAGTACTGCCAGATCGAGCGCCTG
AACAACCTTGAGGCCCTGCCCGGCGACTTCGGCTACACCGTCTCCTGCCTGCCGGTGAAG
CTGGTCGGCTCCGGGGCGGGCTGGGCCCGCGCGGTGGCCCTGGTGGACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [3-185]  9.69999999999989e-35 PF04199
PF04199   Cyclase
SignalP No significant hit
TMHMM No significant hit