close all open/close all

CDS information : Mith_00200


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction23,168 / 22,425 / - [in whole cluster]
23,168 / 22,425 / - [in contig]
Locationcomplement(22425..23168) [in whole cluster]
complement(22425..23168) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Product4'-keto-D-mycarose C-4' ketoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)mtmTIII
EC number
Keyword
  • D-mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
[11853433] Ketopremithramycins and ketomithramycins, four new aureolic acid-type compounds obtained upon inactivation of two genes involved in the biosynthesis of the deoxysugar moieties of the antitumor drug mithramycin by Streptomyces argillaceus, reveal novel insights into post-PKS tailoring steps of the mithramycin biosynthetic pathway. (J Am Chem Soc. , 2002)
[22997042] Cooperation of two bifunctional enzymes in the biosynthesis and attachment of deoxysugars of the antitumor antibiotic mithramycin. (Angew Chem Int Ed Engl. , 2012)

close this sectionSequence

selected fasta
>4'-keto-D-mycarose C-4' ketoreductase [ketoreductase]
MARTTERALSVVVTGGGSGIGRATARAYAAQGAHVLVVGRTAGHLEETAEGQPRIRAFVA
DLADRDAPERIVAAALDATGGIDVLVNNAAVPWRARLGEIDRERAERQVATNLLGPLFLT
QSAVPHMPAGATVVNISSNPPTRGWPANSVYGSTKVGLDFLTLTWAVELAPRGIRVVSVA
PGPTLTPGLTRARSGQPPRQRDDFSRVPLGRPARPEEIAWWITQVTRQEAGYLTGAVLRV
DGGLSVG
selected fasta
>4'-keto-D-mycarose C-4' ketoreductase [ketoreductase]
GTGGCACGGACGACGGAACGCGCCCTGAGCGTCGTCGTCACCGGCGGTGGTTCCGGCATC
GGCCGGGCCACCGCCCGTGCGTACGCCGCCCAAGGCGCACACGTGCTGGTCGTGGGGCGG
ACCGCCGGGCATCTGGAGGAGACCGCCGAGGGGCAGCCGCGCATTCGGGCGTTCGTCGCC
GACCTCGCCGACCGCGACGCTCCCGAGCGGATCGTGGCGGCGGCGCTGGACGCCACCGGC
GGGATCGACGTCCTGGTCAACAACGCCGCCGTCCCGTGGCGCGCCCGGCTCGGGGAGATC
GACCGGGAGCGCGCCGAGCGGCAGGTCGCCACCAACCTGCTGGGCCCGCTGTTCCTGACC
CAGAGCGCGGTGCCGCACATGCCGGCCGGCGCGACGGTGGTCAACATCAGCTCCAACCCG
CCGACGCGCGGCTGGCCGGCCAACTCGGTCTACGGCAGCACCAAGGTCGGCCTGGACTTC
CTCACCCTCACCTGGGCCGTGGAGCTGGCGCCGCGCGGGATCAGAGTCGTCTCGGTGGCT
CCGGGGCCAACGCTGACCCCGGGCCTCACCCGGGCCAGGTCCGGCCAGCCGCCTCGGCAG
CGCGACGACTTCTCCCGCGTCCCGCTGGGCCGCCCCGCCCGGCCGGAGGAGATCGCCTGG
TGGATCACCCAGGTGACCCGTCAGGAGGCCGGCTATCTGACCGGTGCGGTGCTGCGCGTC
GATGGCGGCCTGAGCGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [80-91]  6.99999965558827e-07 PR00080 [131-139]  6.99999965558827e-07 PR00080 [151-170]  6.99999965558827e-07 PR00080
PR00080   SDRFAMILY
 [10-169]  2.7e-28 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  5.29999657550189e-25 PR00081 [80-91]  5.29999657550189e-25 PR00081 [151-170]  5.29999657550189e-25 PR00081 [172-189]  5.29999657550189e-25 PR00081 [208-228]  5.29999657550189e-25 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [11-246]  1.29999999999998e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [138-166]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit