close all open/close all

CDS information : Mith_00220


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction25,452 / 24,466 / - [in whole cluster]
25,452 / 24,466 / - [in contig]
Locationcomplement(24466..25452) [in whole cluster]
complement(24466..25452) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 ketoreductase
Product (GenBank)D-oliose 4-ketoreductase
Gene
Gene (GenBank)mtmU
EC number
Keyword
  • D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[11254130] The mtmVUC genes of the mithramycin gene cluster in Streptomyces argillaceus are involved in the biosynthesis of the sugar moieties. (Mol Gen Genet. , 2001)

close this sectionSequence

selected fasta
>NDP-hexose C-4 ketoreductase [D-oliose 4-ketoreductase]
MPEDRGPLRLGLLGCAGFARRRALPSLARLTEITLTAVASRDAGRAKLFAGEFGGEPVAG
YEELLARDDLDAVYVPLPAALHAPWTGRALEAGLHVLVEKPAAATAAEADRLTRAARERG
LVVMENFGFVHHAQQEAARSLLDEGAIGELRSLTAEFAFPPLPDTDIRYQPGLGGGALLD
AGVYPIRTARLFLGDELEVTGASLREDPGRGVDVAGAALLTGPTGISAHLGFGFVHSYRC
GYTLWGSAGRIGLNRAYSARDDFTPTLTLERDGRVEERRLVPDQQFTTLFRRFAAAVRDQ
DVAGPAHDLAQQARLVERIAATARRLPL
selected fasta
>NDP-hexose C-4 ketoreductase [D-oliose 4-ketoreductase]
GTGCCCGAGGACCGTGGCCCGCTCCGCCTGGGCCTGCTGGGCTGCGCCGGCTTCGCCCGG
CGTCGCGCCCTGCCCTCGCTCGCCCGCCTCACGGAGATCACCCTCACCGCGGTCGCCAGC
AGGGACGCCGGCAGAGCGAAGCTCTTCGCCGGTGAATTCGGCGGCGAACCGGTCGCCGGA
TACGAGGAACTGCTCGCCCGGGACGATCTCGACGCGGTGTACGTACCGCTGCCCGCCGCG
CTGCACGCCCCCTGGACCGGCCGGGCGCTCGAAGCCGGACTGCACGTCCTGGTGGAGAAA
CCGGCGGCGGCCACGGCCGCGGAGGCCGACCGTCTGACCCGCGCGGCCCGCGAGCGCGGC
CTGGTCGTGATGGAGAACTTCGGTTTCGTCCACCACGCCCAGCAGGAGGCGGCCCGTTCC
CTGCTGGACGAGGGCGCCATCGGGGAACTGCGGTCGCTCACGGCCGAGTTCGCCTTCCCC
CCGCTGCCGGACACCGACATCCGCTACCAACCGGGCCTCGGCGGCGGTGCGCTGCTGGAC
GCGGGCGTGTACCCGATCCGGACGGCCCGGCTGTTCCTGGGCGACGAGCTGGAGGTGACC
GGTGCCTCGCTGCGCGAGGACCCCGGCCGCGGGGTGGACGTCGCCGGTGCGGCGCTGCTG
ACCGGGCCGACCGGGATCAGCGCCCATCTGGGCTTCGGCTTCGTCCACTCCTACCGCTGC
GGCTACACCCTGTGGGGCTCGGCGGGACGGATCGGCCTGAACCGTGCCTACAGCGCCCGG
GACGACTTCACGCCGACGCTCACGCTGGAGCGCGACGGACGGGTGGAGGAGCGCCGGCTG
GTGCCCGACCAGCAGTTCACCACGCTCTTCCGGCGGTTCGCCGCCGCCGTCCGTGACCAG
GACGTCGCCGGTCCGGCCCACGACCTCGCCCAGCAGGCGCGCCTGGTGGAGCGGATCGCC
GCCACCGCGCGGCGCCTTCCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [8-126]  1.5e-24 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [139-243]  9.20000000000002e-10 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [6-149]  3.7e-42 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit