close all open/close all

CDS information : Mith_00230


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction26,918 / 25,458 / - [in whole cluster]
26,918 / 25,458 / - [in contig]
Locationcomplement(25458..26918) [in whole cluster]
complement(25458..26918) [in contig]
TypeCDS
Length1,461 bp (486 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)D-olivose, D-oliose and D-mycarose 2,3-dehydratase
Gene
Gene (GenBank)mtmV
EC number
Keyword
  • D-olivose
  • D-oliose
  • D-mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[11254130] The mtmVUC genes of the mithramycin gene cluster in Streptomyces argillaceus are involved in the biosynthesis of the sugar moieties. (Mol Gen Genet. , 2001)
Related Reference
ACC
B3TMP2
PmId
[17985890] Elucidation of the kijanimicin gene cluster: insights into the biosynthesis of spirotetronate antibiotics and nitrosugars. (J Am Chem Soc. , 2007)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [D-olivose, D-oliose and D-mycarose 2,3-dehydratase]
MTQAIMSRKHPAVPPDGLDAPDLRRIAESAAADSGLLSLGGVHDWFEERRKAIRMDVRRI
PFAELQRWGFHPVTGNLAHDSGRFFTVEGLRARSEGPDPVSWSQPIMHQPEVGFLGILVK
EFDGVLHCLMQAKAEPGNAEGLQLSPTVQATRSNYTGVHEGSAVRYLEYFTDPGKGRPLV
DVLQSEHGSWFFRKRNRNLVVEAVGDVPEHEDYRWLTLGQVRRLLGVPDLVNMDTRTVLA
CLPVAPPDGSLEGVTTDGSRGAAVAALTASLSAQAPAAHTLPELLRWFNGLRARSEVAAQ
LVPLTSVDGWVRDTDEIRHTSGRHFAIVAVSVEAGNREVKGWTQPLLSPRGTGVVAFLAK
RIDGVLHVLARAHPEPGYVDLIELAPTVQCVPDDHAHLPPEQRPRFLDQVLAARPEQILY
DAVQSEEGGRFYRALSRYLVVETDEDPVVPDDYRWMTVAQLVALLQHSNYCNIQARSLIA
CLQSVW
selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [D-olivose, D-oliose and D-mycarose 2,3-dehydratase]
ATGACTCAAGCGATCATGAGCAGAAAGCATCCAGCGGTCCCCCCGGACGGCCTCGACGCG
CCGGATCTGAGGCGCATCGCCGAATCGGCGGCGGCCGACAGCGGACTGCTGTCCCTGGGT
GGTGTCCACGACTGGTTCGAGGAGCGCCGCAAGGCCATCCGGATGGACGTGAGGCGCATC
CCCTTCGCCGAGCTCCAGCGCTGGGGCTTCCACCCGGTCACCGGGAATCTGGCGCACGAC
AGCGGCCGCTTCTTCACCGTCGAAGGGCTGCGGGCTCGCTCCGAGGGCCCGGACCCCGTC
TCCTGGTCCCAGCCGATCATGCACCAGCCGGAAGTGGGTTTCCTCGGCATCCTGGTCAAG
GAGTTCGACGGTGTCCTGCACTGCCTGATGCAGGCGAAGGCCGAGCCCGGCAACGCCGAG
GGACTCCAGTTGTCGCCCACGGTGCAGGCCACCCGCAGCAACTACACGGGCGTGCACGAG
GGCAGCGCCGTGCGGTACCTGGAGTACTTCACGGACCCCGGCAAGGGCCGGCCGCTGGTC
GACGTGCTCCAGTCCGAGCACGGTTCCTGGTTCTTCCGCAAACGCAACCGCAATCTCGTC
GTCGAGGCCGTCGGCGACGTGCCCGAGCACGAGGACTACCGCTGGCTGACCCTCGGTCAG
GTCCGCCGGCTGCTCGGCGTCCCGGACCTGGTCAACATGGACACTCGGACGGTCCTGGCC
TGCCTCCCCGTCGCCCCGCCGGACGGTTCCCTCGAGGGAGTCACGACCGACGGTTCCCGC
GGGGCGGCCGTGGCCGCCCTGACCGCCTCCCTGTCCGCGCAGGCCCCCGCCGCGCACACC
CTGCCCGAGCTGCTGCGCTGGTTCAACGGGCTCAGGGCGCGCAGCGAGGTCGCCGCGCAG
CTCGTCCCGCTGACCTCCGTGGACGGCTGGGTCCGCGACACGGACGAGATACGCCACACC
AGTGGACGGCACTTCGCGATCGTCGCCGTGTCTGTGGAGGCCGGCAACCGCGAAGTCAAG
GGGTGGACCCAGCCGCTGCTCAGCCCGCGCGGCACCGGGGTGGTGGCGTTCCTGGCCAAG
CGGATCGACGGCGTCCTCCACGTCCTGGCGCGCGCCCACCCGGAACCGGGCTACGTCGAC
CTCATCGAGCTGGCCCCGACCGTCCAGTGCGTCCCCGACGACCACGCTCATCTCCCCCCC
GAACAGCGGCCCAGGTTCCTGGACCAGGTGCTCGCGGCCCGGCCGGAGCAGATCCTCTAC
GACGCCGTGCAGTCCGAGGAGGGCGGCCGTTTCTACCGGGCGCTGAGCCGCTACCTGGTG
GTCGAGACGGACGAGGATCCCGTCGTGCCCGACGACTACCGCTGGATGACGGTGGCGCAG
CTGGTCGCCCTGCTCCAGCACAGCAACTACTGCAACATCCAGGCCCGCAGCCTCATCGCC
TGTCTGCAGTCCGTCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [40-242]  4.69999999999992e-81 PF03559 [280-482]  2.90000000000003e-81 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit