close all open/close all

CDS information : Mith_00240


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction27,067 / 28,047 / + [in whole cluster]
27,067 / 28,047 / + [in contig]
Location27067..28047 [in whole cluster]
27067..28047 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-4' ketoreductase
Product (GenBank)putative side chain reductase
Gene
Gene (GenBank)mtmW
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12733914] Mithramycin SK, a novel antitumor drug with improved therapeutic index, mithramycin SA, and demycarosyl-mithramycin SK: three new products generated in the mithramycin producer Streptomyces argillaceus through combinatorial biosynthesis. (J Am Chem Soc. , 2003)
[16571899] Novel GC-rich DNA-binding compound produced by a genetically engineered mutant of the mithramycin producer Streptomyces argillaceus exhibits improved transcriptional repressor activity: implications for cancer therapy. (Nucleic Acids Res. , 2006)
Related Reference
ACC
Q70J78
NITE
Chro_00200
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative C-4' ketoreductase [putative side chain reductase]
MVAVEFRSLGRSGLSVSEIVYGNLLYPQDDTPDEVVLSSIRAALDAGVTTFDTADVYGMF
RSESLLGRALAGTPREELVLCTKVGMPTGFGPNGRGLSRKHVMESVDGSLRRLRVDHIDV
YTAHRYDPATPLEELMWTFSDLVRAGKILYVGMSEWPVERIAEAAGIGARLGVPVICHMP
RYSMLWRAPEAEVIPACRDLGIGQICYFTLEQGVLTGKYAPGAPPPAGSRATAPKGGRAP
LMRRWLDDDKVLGRVERLRPLAEEAGLTTAHLAWVLQNPAVSGAVIGSFNAEQVLANAES
AGVRLETDLLVRIDEVLGDSVVHDEE
selected fasta
>putative C-4' ketoreductase [putative side chain reductase]
GTGGTCGCCGTGGAGTTCCGAAGCCTTGGCCGAAGTGGCCTTTCAGTGAGTGAGATCGTG
TACGGCAACCTGCTGTACCCGCAGGACGACACCCCCGACGAGGTGGTTCTCTCCTCGATC
AGAGCGGCCCTTGACGCCGGGGTGACGACCTTCGACACCGCGGACGTCTACGGCATGTTC
CGCTCCGAGAGCCTGCTGGGCCGGGCACTGGCCGGCACGCCCCGCGAAGAGCTGGTGCTG
TGCACCAAGGTGGGGATGCCGACCGGGTTCGGGCCCAACGGACGGGGGCTGTCGAGGAAA
CACGTCATGGAGTCCGTCGACGGCTCGCTGCGCCGTCTGCGCGTCGACCACATCGACGTC
TACACCGCGCACCGCTACGACCCGGCGACTCCGCTGGAGGAGCTGATGTGGACCTTCTCC
GACCTGGTACGGGCCGGGAAGATCCTCTACGTCGGCATGTCGGAATGGCCCGTGGAGCGG
ATCGCCGAGGCGGCCGGGATAGGTGCGCGGCTCGGTGTGCCGGTGATCTGTCACATGCCC
CGCTACTCGATGCTGTGGCGGGCGCCGGAGGCCGAGGTGATCCCCGCCTGCCGTGACCTG
GGCATCGGCCAGATCTGCTACTTCACCCTGGAACAGGGCGTGCTGACGGGCAAGTACGCG
CCGGGCGCCCCGCCCCCGGCCGGGTCCCGGGCCACGGCACCCAAAGGTGGCCGGGCCCCG
TTGATGCGGCGCTGGCTGGACGACGACAAGGTCCTCGGGCGCGTCGAGCGGCTGCGTCCG
CTCGCCGAGGAGGCCGGGCTGACCACGGCGCACCTCGCGTGGGTGCTCCAGAATCCCGCC
GTCAGCGGGGCCGTCATCGGCTCGTTCAACGCCGAACAGGTCCTGGCCAACGCCGAGTCG
GCCGGCGTCCGTCTGGAGACGGACCTGCTGGTGAGGATCGACGAGGTCCTGGGCGACTCC
GTCGTGCACGACGAGGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [5-318]  4.59999999999996e-83 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [18-316]  1.29999999999998e-61 PF00248
PF00248   Aldo_ket_red
 [4-325]  2.50000909916183e-81 SSF51430
SSF51430   Aldo/ket_red
SignalP No significant hit
TMHMM No significant hit