close all open/close all

CDS information : Mith_00250


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction28,338 / 29,561 / + [in whole cluster]
28,338 / 29,561 / + [in contig]
Location28338..29561 [in whole cluster]
28338..29561 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)mtmGIV
EC number
Keyword
  • trisaccharide 1st D-olivose
  • trisaccharide 3rd D-mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)
[22997042] Cooperation of two bifunctional enzymes in the biosynthesis and attachment of deoxysugars of the antitumor antibiotic mithramycin. (Angew Chem Int Ed Engl. , 2012)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRILFTTFPWHSHHFPMVPLESAALAAGHEVRVASAPALMPVVTASGLPGIPVGQDVDLA
SLSNDRSRAAWHVQDRWPDDWPVRPELLDDEQFALIENLGRMQTVMASAMLDDLLSFARY
WRPDLVVHDAVSLAGPVVAAALGVPNVSHLWGTPGLQRIELRRMGGEPLPEYVRLYERAG
TTVRTEPSAWIDPSAPGIRYPAGPTCRQMRYVPYNGPGLLPDWLRREPSGSRVCVTWGAT
SMALRGGTVVELVRQCVEAAAEVADEVVVAVTEQTARALEDTPLPDHARVAVGLPLHLLV
PSCDLVVHHGGAGTSMTAAVAGVRQLLITTRPEPTVNGTRLAASGAARHLMTTEVPAARE
GVLLLRAEMDRLLSDPAHGAAARRLADGIRTQPAPADVVAELTHLVR
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCATTCTGTTCACCACGTTCCCCTGGCACTCCCATCACTTCCCGATGGTCCCACTG
GAGTCGGCGGCGCTGGCCGCCGGGCATGAGGTGCGGGTCGCGAGCGCGCCCGCGCTGATG
CCGGTCGTGACCGCGTCCGGCCTGCCCGGGATACCGGTCGGCCAGGACGTGGACCTTGCC
TCCCTGTCCAACGACCGCAGCCGGGCCGCCTGGCACGTTCAGGACCGCTGGCCCGACGAC
TGGCCCGTCCGTCCGGAACTCCTCGACGACGAGCAGTTCGCGCTGATCGAGAACCTGGGA
CGGATGCAGACGGTCATGGCCTCGGCCATGCTCGACGACCTGCTGAGCTTCGCCCGGTAC
TGGCGGCCCGACCTGGTGGTGCACGACGCCGTCAGCCTCGCCGGCCCGGTGGTCGCCGCC
GCGCTGGGCGTGCCCAACGTCAGCCACCTGTGGGGCACTCCGGGACTCCAGCGCATCGAG
CTGCGCCGCATGGGCGGCGAACCGCTGCCGGAGTACGTCCGGCTGTACGAGCGGGCGGGA
ACGACGGTGCGGACCGAGCCCAGTGCCTGGATCGACCCCAGTGCCCCCGGCATCCGGTAC
CCGGCCGGACCGACCTGCCGTCAGATGCGGTACGTGCCCTACAACGGCCCGGGCCTGCTG
CCGGACTGGCTGCGCCGGGAACCGTCGGGCAGCCGGGTCTGCGTCACGTGGGGCGCCACC
TCCATGGCCCTGCGCGGCGGCACCGTCGTCGAACTCGTACGCCAGTGCGTGGAAGCCGCC
GCCGAGGTGGCCGACGAGGTCGTCGTCGCGGTGACCGAACAGACCGCGCGGGCGCTGGAG
GACACGCCGCTGCCGGACCACGCACGCGTCGCGGTCGGATTGCCGCTGCACCTGCTGGTG
CCGTCCTGCGACCTCGTGGTCCACCACGGTGGCGCCGGCACCAGCATGACCGCCGCGGTC
GCGGGCGTACGACAGCTGCTGATCACCACCCGGCCCGAGCCCACGGTCAACGGCACCCGG
CTGGCCGCGTCGGGCGCCGCCCGGCACCTGATGACCACGGAGGTCCCCGCCGCCCGGGAG
GGAGTGCTGCTGCTGCGCGCCGAGATGGACCGTCTCCTATCGGACCCCGCACACGGCGCC
GCCGCGCGGCGGCTGGCCGACGGCATCCGCACCCAGCCCGCACCGGCCGACGTGGTGGCG
GAGCTGACGCATCTCGTCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-148]  3.1e-09 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [191-289]  1.99999999999999e-23 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit