close all open/close all

CDS information : Mith_00260


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction29,634 / 30,824 / + [in whole cluster]
29,634 / 30,824 / + [in contig]
Location29634..30824 [in whole cluster]
29634..30824 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-oliose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)mtmGIII
EC number
Keyword
  • trisaccharide 2nd D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)

close this sectionSequence

selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
MRVLVTTSPWPTHYFVVQPLAAAFRAAGHEVLVAAQPSMADLVTRSGLPMAAVGSDIDMV
DIRRKTLSQELDARQKPGEPARADDGGQVFDTWQQATLANLDPVMDLARTWKPDLVLADT
MCPPGLVAAQELGVPGIRHLWGWDFYGSAGSEQILAELPGFYDVYRAHGLDVQGDPARRT
VDPCPPSLQPPASPARLQVQYVPYNGAGRAPGPELRRTDKSRPRVCLTWGRSITRIMGER
AFLLPRVVRALDGLDIEIVVAADAATHAKLGELPDNVRVLDSPPLHLLLDDCDAIVHQGG
SGTVLNAIRVGLGQLAISHMADQDNISAALAGSGAGIHLRGEQAAEEAIRAAVIRLLEDP
DIRMSADRLRAEMLSQPTPAQVAAGLDELATAHAHH
selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
ATGCGCGTTCTGGTGACCACGTCCCCGTGGCCCACCCATTACTTCGTCGTCCAGCCGCTG
GCCGCCGCGTTCCGCGCGGCGGGCCACGAAGTCCTCGTGGCGGCCCAGCCGTCCATGGCG
GACCTGGTCACCCGGTCCGGCCTGCCCATGGCCGCCGTCGGCAGCGACATCGACATGGTG
GACATCCGCCGCAAGACGCTCTCCCAGGAACTGGACGCCCGTCAGAAGCCCGGGGAACCC
GCCCGGGCCGACGACGGCGGTCAGGTCTTCGACACCTGGCAGCAGGCCACCCTCGCCAAC
CTCGACCCGGTCATGGACCTCGCCCGGACCTGGAAACCGGACCTGGTGCTCGCCGACACC
ATGTGCCCGCCGGGCCTCGTCGCCGCACAGGAACTCGGCGTGCCGGGGATCCGCCACCTG
TGGGGCTGGGACTTCTACGGCTCGGCCGGCAGCGAGCAGATCCTCGCCGAACTCCCGGGC
TTCTACGACGTGTACCGCGCCCACGGACTGGACGTCCAGGGCGATCCCGCACGGCGCACC
GTGGACCCCTGCCCGCCGAGCCTCCAGCCGCCCGCCTCGCCCGCCCGGCTCCAGGTGCAG
TACGTGCCGTACAACGGTGCGGGCCGCGCCCCAGGACCGGAGTTGCGTCGCACGGACAAG
TCCAGGCCGCGGGTGTGCCTCACCTGGGGAAGGTCGATCACCCGGATCATGGGCGAGCGG
GCCTTCCTGCTGCCGCGGGTCGTCCGGGCGCTCGACGGCCTGGACATCGAGATCGTGGTC
GCCGCCGACGCCGCCACCCACGCGAAGCTCGGCGAACTCCCCGACAACGTCCGCGTCCTC
GACTCGCCGCCCCTGCACCTGCTGCTCGACGACTGCGACGCCATCGTCCACCAGGGCGGC
TCGGGCACCGTGCTCAACGCGATCCGGGTCGGCCTCGGCCAGCTGGCCATCTCGCACATG
GCCGACCAGGACAACATCTCCGCCGCGCTCGCCGGGTCGGGCGCCGGCATCCACCTGCGC
GGCGAGCAGGCCGCCGAGGAGGCCATCCGCGCCGCGGTGATCAGGCTCCTCGAGGACCCG
GACATCCGCATGTCGGCGGACCGGCTGCGCGCCGAGATGCTCTCCCAGCCCACCCCCGCC
CAGGTGGCCGCCGGACTCGACGAGCTGGCCACCGCCCACGCCCACCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [13-139]  5.6e-10 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [181-278]  4.9e-26 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit